AbuseIPDB » WHOIS 167.99.141.59

Check an IP Address, Domain Name, or Subnet

e.g. 3.236.28.137, microsoft.com, or 5.188.10.0/24

167.99.141.59 IP Address Information

ISP DigitalOcean LLC
Usage Type Data Center/Web Hosting/Transit
Hostname ss-dev.duckdns.org
Domain Name digitalocean.com
Country
City Frankfurt am Main, Hessen

ss-dev.duckdns.org

Subdomains

  • tardisjenkins
  • extend
  • igloo15
  • anjoscam
  • sadale
  • mauromaggioni
  • xuncdlud
  • bitogeranbito
  • xdroq8vz
  • zekiheifu
  • skelectronics
  • presoftdemo
  • kirppustan
  • lyrabar
  • opennota2
  • solarfarm
  • cvdeny
  • copernico
  • ls4pres
  • differenthood
  • plrss
  • stevenw
  • zetagan
  • darethehair
  • dailymenaccessories
  • ytrizja
  • frankestein
  • hypercube-softwares
  • baka
  • hynde
  • plutaajat
  • beyondwind
  • digitaldoge
  • ld33
  • goosecloud
  • eevobfugb
  • armory
  • joska
  • wimpanzee
  • xxxx
  • subdomain
  • yourdomain
  • xxx
  • coh
  • homeseries
  • 10mbit
  • 173automation
  • 1820
  • 216
  • 2537886571
  • 4-837185464
  • 5784
  • 5gibbs
  • 5ngz0q4
  • 963
  • adillusbeast
  • adismartgar
  • agvagen
  • aikio
  • aishaefred
  • aizawamako
  • alterioslegris
  • amandel
  • amha
  • andersonfam
  • annnkeith
  • anthsonic
  • antonioalvarezternero
  • apollokid
  • appeas
  • asohn
  • atardif
  • ausrhino
  • av25
  • awesemo
  • banquepopulaire
  • barrera8115
  • battalpi
  • berci
  • besscasa
  • bjbe
  • bjerre-iot
  • bofaupgrade
  • bucysxda
  • buizerhome
  • butu
  • c123
  • carloseugenio
  • casacarasau
  • casaspassanetti
  • casastewie
  • charlottedaniel
  • chryso
  • comandovitimas
  • comvi36fa
  • conradbraga
  • cool-junk
  • cotesti
  • cpanel.thsu2
  • cpcontacts.comcas
  • craftedfollowing
  • cust0016-cwadmin
  • d4fl0w-hass
  • darkii89
  • darkness6
  • daubsonarr
  • dawseyhass
  • dbmmmyqppd
  • decaroj
  • delig66li
  • dep-verification-credit-agricole
  • descargar-intagram
  • devolga
  • dobriynextcloud
  • doublew
  • dred981
  • drivealfaiot
  • drupalstaging
  • dtiserver
  • earendil2
  • ecpcloud
  • edwardshouse
  • egorzumbeispiel
  • elfworld9875
  • emb-homeassis
  • enziwurz
  • euirjhd
  • fakoreis
  • fammar-emby
  • farmroad
  • fjlercloud
  • flemming50
  • francesco1029
  • fredericocassola
  • freenas.linktelypf
  • freeskinz
  • fuashoa
  • furusund
  • gescars65toy
  • globo18
  • gnsiva
  • graphaccep
  • gw1
  • harrish
  • heemdelco
  • hisfemetdi
  • hoetinghass
  • hog
  • homeassistantru
  • homebzz
  • homecctvnetwork
  • houk
  • hydemovies
  • iaguilar
  • igetmoney
  • imrafferty
  • insemibee
  • iotlabtuke
  • jaxklag
  • jbcjsr
  • jennifertowernextcloud
  • joaco
  • jonasmalene
  • jonathanjoestarnextcloud
  • julevarmt
  • katastrophal
  • kimlergelmiskimler
  • kintonffmbck
  • km-bponc
  • konvallvegen
  • labrawho
  • lawall
  • lesznowola
  • levinsteinha
  • lisafwi
  • lively
  • lsdc
  • lundbergs
  • mail.30-30526632
  • mail.gett-clasher
  • mail.submit-details-chao8b-security-update
  • mail.vfit3dlmxu
  • mano-namas
  • manual
  • maols2
  • maratong
  • marcohuis
  • mechanus
  • megiehassio
  • mercosal
  • mgirdner
  • michellee-obama
  • mindmaster
  • mkavkyhv
  • mkectiboks
  • mmkkppolleiwwe
  • mnx
  • mokson
  • montanapegaso
  • mse-homelab
  • mta-sts.1boggled
  • mta-sts.airesonic-danhyal
  • mta-sts.beancloud
  • mta-sts.cesariello
  • mta-sts.cheapbeer
  • mta-sts.chrisblomkvist
  • mta-sts.dagnabbit
  • mta-sts.delain
  • mta-sts.elmsdm
  • mta-sts.epicstratton
  • mta-sts.footehass
  • mta-sts.foreshore
  • mta-sts.fostercoders
  • mta-sts.gtf
  • mta-sts.hkbaby
  • mta-sts.jaa
  • mta-sts.javierpelado
  • mta-sts.jcbhassio
  • mta-sts.jkc-hassio
  • mta-sts.jtbhass
  • mta-sts.juse
  • mta-sts.kanandian
  • mta-sts.laborde
  • mta-sts.lafamille
  • mta-sts.lymanbuttler
  • mta-sts.mad-hat
  • mta-sts.mail.mlfreeskin
  • mta-sts.maison-rouge
  • mta-sts.michaelcomputer
  • mta-sts.mta-sts.anhletuan
  • mta-sts.mta-sts.brissman
  • mta-sts.mta-sts.ezarowny
  • mta-sts.mta-sts.fleeve
  • mta-sts.mta-sts.fluffycloud
  • mta-sts.mta-sts.gnoid01
  • mta-sts.mta-sts.hascooterm
  • mta-sts.mta-sts.hoangviethome
  • mta-sts.mta-sts.hunteraccess
  • mta-sts.mta-sts.jonnybhass
  • mta-sts.mta-sts.lunahome
  • mta-sts.mta-sts.mancelabs
  • mta-sts.mta-sts.martinduck
  • mta-sts.mta-sts.murispi
  • mta-sts.mta-sts.nerdbot
  • mta-sts.mta-sts.nobloodynetwork
  • mta-sts.mta-sts.okashii
  • mta-sts.mta-sts.onccvr
  • mta-sts.mta-sts.psyserver
  • mta-sts.mta-sts.rax
  • mta-sts.mta-sts.rlach
  • mta-sts.mta-sts.roroscloud
  • mta-sts.mta-sts.smartolat
  • mta-sts.mta-sts.thunderhassio
  • mta-sts.mta-sts.trinquette
  • mta-sts.mta-sts.welshnetworkvpn
  • mta-sts.mullenraid
  • mta-sts.nasferatuportainer
  • mta-sts.ngoducanh
  • mta-sts.nicola-bertelli
  • mta-sts.ntautomate
  • mta-sts.redir-oferta1
  • mta-sts.rss.ki3lich
  • mta-sts.ryanknut-debian.ryanknut
  • mta-sts.sghass
  • mta-sts.tg-remote
  • mta-sts.thechapmanhome
  • mta-sts.tuycasa
  • mta-sts.unifi.jacklikea
  • mta-sts.uuzubfvpwtl
  • mta-sts.villalinne
  • mta-sts.webdisk.korea-porn
  • mta-sts.webmail.oty4nta3nzoxm
  • mta-sts.woodcote
  • musenet20
  • naiernxc
  • nateshouse
  • nextcloudoe
  • nextcloudrpi
  • noducklife
  • norbee007
  • nunopequito
  • nxdeconz
  • nzforombi
  • oges
  • oldeye
  • oscenfuer
  • pbunker61
  • pedemanga
  • pedersenteck
  • pinghome
  • pl-medi
  • plexstream20
  • preciouslight
  • princess-to-do-list
  • prod
  • protocolo1
  • ptv38
  • pvkesler
  • pwouters
  • qdnynayefs.gagc
  • qfch
  • quobar46semb
  • rainbowcarnage
  • razyosi
  • reisnergate
  • rexchan
  • rgowsdneiaq
  • ritualz
  • rivashopo
  • rlsparadise
  • robbot
  • romanka
  • ronaldbeukema
  • rozenfontein
  • rpntest
  • rtek116
  • sablefort
  • saga-home
  • sat3
  • schlibib
  • sdacha
  • securisation-necessaires
  • severnaya
  • sfsytuj
  • shadnet
  • srjp
  • ss0-g0dady-c0m-25-2
  • steeze
  • stegle
  • stokeduck
  • stung
  • subzar
  • surkaeybtlvd
  • t9
  • tezragore
  • tholar
  • thucnghiem
  • toobz
  • tyroniusz
  • uniclass2
  • unraidmainnextcloud
  • vmarquar
  • voronhome
  • vunm
  • vutruonghainam
  • wattssub
  • webdisk.13-7704535
  • webdisk.34-34391673
  • webdisk.holanewvideofbook
  • webdisk.laterbin
  • webdisk.madeinindia
  • webdisk.xvideos0062
  • webmail.58-0601773
  • webmail.65-48925188
  • webmail.delivs
  • webmail.give-event-mobile-legends
  • webmail.qwertyview
  • wetransferfax
  • whatsxxxapp
  • wim
  • wins
  • wooyerfrp
  • www.admin-serveur
  • www.bedrock9
  • www.bekkefaret
  • www.donal-trump
  • www.error-trial
  • www.garena-event
  • www.leondutton
  • www.menzoberanza
  • www.mta-sts.mta-sts.plex.mricy
  • www.rdgc6mjoxnt
  • www.rknextcloud
  • www.securedonline.thyrgbn
  • www.squareup-homeloginaccessjhgf
  • x3789
  • xnxx-new-link
  • xyborg-sonarr
  • yarisvoit
  • zeusboxserver
  • zhaaar
  • zm-bandk
  • zymr-nginx
  • 24-days
  • 360av
  • 50wells
  • alarson-hass
  • apple-tree
  • astravaltv
  • ba7c4
  • barneyhomeaut
  • blakeha
  • blitzplex
  • bndmaidcswud
  • bretagne
  • bw-geras
  • candeskfast
  • catarrotxa
  • cdsmith
  • centraalspoor
  • cnet
  • cpanel.syrianghozy
  • cpanel.tmwodo2mze4fe
  • cpanel.vfit3dlmxu
  • cvd-19
  • devsejin
  • dknextcloud
  • doornkamp
  • echem
  • entp003
  • facebook-checkpoint-next-logins
  • fackohas
  • fets
  • fjantus
  • forestriver
  • frisnvr
  • g9000
  • ganucaha
  • glpi-taffe
  • gundersen
  • h0me-ass1stant1978
  • happjg
  • hasina
  • heia
  • hellocody
  • hkalo08
  • hohoangan
  • homeassistantjswg17
  • homelonghome
  • hungdinh
  • isimsiz-turk-tumblr-com.sumply12vau
  • jacksnake
  • jdy
  • jordyverbeek
  • josevillaio
  • jsdm
  • kaigrassnick
  • karthik85
  • kiznannse
  • kokoriko
  • legacybuilder
  • lggn-mricrosftonline-c0m9ikr
  • libs4ojd50
  • loosnet
  • lucianorb
  • lucky2021-cobra
  • lufneet7
  • mail.1-access-verlfy-user-bofa-css
  • mail.28534r
  • mail.dustsin
  • mail.tuoiteenmomong15
  • mail.xcavideoaftv
  • maudcloud
  • mhimc
  • mta-sts.astbert
  • mta-sts.bogdanha
  • mta-sts.bookstack.clackertastic
  • mta-sts.bunqeteer
  • mta-sts.cpanel.lucille
  • mta-sts.crystalhass
  • mta-sts.cunningham
  • mta-sts.eldritch-eidolon
  • mta-sts.first1gga
  • mta-sts.freeshop18
  • mta-sts.ginopilotino
  • mta-sts.hassioteste
  • mta-sts.hhorsen
  • mta-sts.illtempered
  • mta-sts.jarvis-marcogeerarts
  • mta-sts.jngcwruzseqmihuc6zbdznbf
  • mta-sts.mta-sts.elacoutreach
  • mta-sts.mta-sts.herbaljelly
  • mta-sts.mta-sts.huizerweggrafana
  • mta-sts.mta-sts.koraal43
  • mta-sts.mta-sts.lanceuppercut
  • mta-sts.mta-sts.monchegorsk
  • mta-sts.mta-sts.nelsonstoik
  • mta-sts.mta-sts.unraidbox
  • mta-sts.mta-sts.zip18
  • mta-sts.rustyrocket
  • mta-sts.spmhouse
  • mta-sts.thestottlemyers
  • mta-sts.trans-ikuru
  • mta-sts.uniromae
  • mta-sts.webdisk.1jroji6mtux
  • mta-sts.www.derespirator
  • nakitasdf
  • naomitang
  • ncoffo
  • newvideohotsfbcom
  • nextcloud.nuagesbrumeux
  • nikiserverdz
  • nilor
  • notehabulikan
  • openvpnmx
  • oxfopyzmnc
  • pawleysplayr-homeassistant
  • pedrodomotica
  • pet43k
  • petralanda
  • phattx3
  • pituly
  • plex.woodcote
  • ppy
  • pvoilphumy
  • qu1x-gr1
  • radarr.vggallego
  • ragnabo8
  • reifenschweiler
  • reverify-secure07b-chase
  • rizxakxaag
  • safasadsadsad
  • sanjak
  • sbrome
  • sdjfgjkasdgjf
  • seafile-puxtrilserv
  • securityde
  • services-activation87393verifimescomptes
  • sigsig
  • sleeperservice
  • smarthometesla
  • smartnas
  • specter-proxy
  • sub-crit
  • tairi3
  • tiagondelgado
  • tj-homeassistant
  • truckee
  • turbonetha
  • tylerhass
  • veit
  • video-japan-linda-brown-lfv
  • vikoba
  • vuursteen
  • vwifi
  • warneedle
  • webdisk.capitalone-security
  • webdisk.secure-chase07-online-web
  • webdisk.webapi-securedata03-connection-dashboard
  • webmail.chaseonline-03tk9
  • webmail.l2sacamuu
  • webmail.loginfacebook19
  • webmail.lossaa
  • webmail.ricehasa
  • webmail.secure-infochase-update-server
  • webmail.subrepost-accinf0-rec0very
  • webmail.tuoithomong007
  • whroad
  • wibh
  • wiessha
  • wwmemfnnz
  • www.activityrep0rtsunusu4lactic1tiesinc
  • www.anotherwhm1
  • www.arud
  • www.gdhsd
  • www.globo242628
  • www.jpridd
  • www.kuhl
  • www.sexygirl230
  • www.streamtogether
  • www.tfgcgfgh
  • www.thomashp77
  • www.update-information
  • www.wonkus
  • xurde
  • yotklkpyl
  • yymanobpcc
  • zmhomelink
  • arpayable
  • barloukahassio
  • copavoip
  • cpanel.bcrotctr
  • cpanel.bokepviral18-whasappgrup
  • cpcalendars.group-whatsapp-notnot8
  • cpcalendars.notnot.grub-whatshapp-net
  • cpcontacts.jandangocokxx
  • cpcontacts.whatsapp-chat2021new
  • ddesqi4
  • desirdp
  • dsfsdgds
  • fltvs
  • hgfsssrrdv
  • iiwjjjwjii
  • jkiddserver
  • jtbmajbgcn
  • kdhsmrkpxj
  • mir33
  • primal-id
  • secureactnma01
  • textlob70q
  • webdisk.online2wellsfargo
  • webmail.frontalgamingevent
  • webmail.grubchat-whatsappcom
  • woodster6666
  • 222061297665719195483120436571215602917
  • 2889721664
  • 2c6cac27
  • 2ugdfisjwfj4uksd6yghh7r3
  • 4794516449
  • 63271
  • 75
  • 88bevd83bro2
  • aa.newbra
  • abgoute
  • ablbkb
  • abrjxgvbrk
  • actualtruth
  • adrianmeet
  • adrieron
  • agropi
  • aidan-network
  • aintira
  • aksellcollabora
  • alexhahn
  • anrmsdepg
  • antoinecreux
  • any140
  • applemyid-verifyaccount
  • asjkayuera
  • asox-ad0behost-nov16-5
  • atari.osmc-wf
  • auth17
  • authnewreport
  • avvnxcr356
  • bafiohome
  • basehomeass
  • beefnet
  • beefworld
  • berg10
  • bingpowsonarr
  • bitwardendeb
  • bladibla.kinlao
  • bowtie-demo
  • brownes-farm
  • buihuuthanh
  • califaxtwo
  • canohealth
  • cap1plex
  • capaseotaw
  • cbappserver02
  • cementerio-123
  • cgstuhhhuu
  • charon
  • che-workspace.workspace.trt-mibl
  • chieti
  • chneswsdy8wealthandorganisationjokbo
  • chrispw
  • cleverest-eu
  • client
  • coas
  • colonelu01
  • community-support
  • computandodragones
  • cpanel.expressbpi-teamsupport
  • cpanel.goldring
  • cpanel.kore3-xkasnfkasjansf
  • cpanel.locomotivedesk
  • cpanel.onl1ne-chas3e-ver-account0c
  • cpanel.phimjavporn
  • cpanel.pubgitems11
  • cpanel.update-account-secure01b-chase-online
  • cpanel.videohay2019
  • cpanel.weatherforcast
  • cpanel.wtusb
  • cpaypal-co-frde-mailapps-7
  • cpcalendars.ernailvisindomain
  • cpcalendars.loginmgrinomixcroso0fs0nl1ne0nline
  • cpcalendars.manage-info-app2-update
  • cpcalendars.memb-ership-restart-net-flix
  • cpcontacts.codechuan
  • cpcontacts.stefanolucciano
  • cpcontacts.webmail-metalink-com32
  • ctuxypztibc
  • currentappstore8826738383updateapple
  • cyber-helen-box
  • d40-sonarr
  • d4f0c0s
  • danylosbnextcloud
  • debianbox
  • defdico
  • deluge.zbartos
  • dflnjvqltp
  • dghjkl
  • diogobc
  • domoticadenis
  • donalduck89
  • dorktastic
  • drazler
  • drhdomotic
  • du10
  • dvcasa
  • dybalacddap
  • dylansdorm
  • edmondsdigital
  • emiller
  • eviltant
  • expressams
  • fab22
  • fagodi
  • faikoloko
  • fambien
  • fefplex
  • feminineywu
  • fipxoinlsh
  • flythecoup
  • franmark
  • fsoares
  • ftp.whitlock843
  • gaditamanipulats
  • ghmldilwfx
  • ghvdncdghbnx
  • gigantic
  • gigiapartment
  • gogons
  • goodyourbook
  • googlehomethanh
  • gr0upbokep-indo9
  • ha-asst
  • ha-nightshademanor
  • habtec
  • hahs46
  • hamagm
  • hetcaret
  • hfscddqppv
  • hgjgkfkrk
  • hookupuok
  • hotvideomexxico
  • hqidesfgxp
  • hum4nsh1eld
  • huythanh
  • hyperds
  • iagohack
  • icedophass
  • indenpeschen
  • instagramlive
  • jalexladd
  • jeffathome
  • jeniusflexi
  • jhegw
  • jitsielguimar
  • jkombi
  • join-gruptante18
  • jscrambler
  • kaizeen
  • kato-home-ngmr
  • kipuhvelluhhenky
  • kjaerspliid
  • kkihgc60
  • konto-uberprufung-amz-bacun121
  • kubanishku
  • kvikanextcloud
  • kyleconley
  • lesftudi
  • levery
  • lightshow.pbezant
  • lij
  • live-1
  • login-microsftonline-com
  • lphha
  • m1c7o3o5t0n3c4alln0wv3r1fic4ti0n
  • maguu4
  • mail.app-manage-informations-update
  • mail.bokepvirl2020
  • mail.clipxxnusinh
  • mail.ffver
  • mail.hotface-cute
  • mail.kldgskgosdog
  • mail.postiofice
  • mail.securel1-accountalertvertification
  • mail.shoers
  • makwana
  • maldacu
  • mamahgasukapapah
  • manageapp-chaseb09-infos
  • manufacturedomain
  • maurolopes
  • meetyni
  • melle
  • methear85gua
  • mjsmith
  • mobilelegendsnew6
  • mockupgenio
  • mokinos
  • mortymcfly
  • motherpure
  • mqttfayk
  • ms83
  • mschimper
  • mskha
  • mta-sts.absi
  • mta-sts.auth.mrshow
  • mta-sts.ayraayra
  • mta-sts.bethusy
  • mta-sts.brodsgaard
  • mta-sts.crazymonkhome
  • mta-sts.dkzbx
  • mta-sts.fatmanhome
  • mta-sts.genotek2
  • mta-sts.glanz
  • mta-sts.home-danomoseley
  • mta-sts.jflopmadre
  • mta-sts.kacdown
  • mta-sts.krugerfamily
  • mta-sts.ldln
  • mta-sts.lolog
  • mta-sts.lvl2lower2g
  • mta-sts.mail.dmc07
  • mta-sts.mail.outoulhlmjb
  • mta-sts.minhkhai
  • mta-sts.mta-sts.biezenveld
  • mta-sts.mta-sts.bu3
  • mta-sts.mta-sts.casapaletto
  • mta-sts.mta-sts.crisflashin
  • mta-sts.mta-sts.curlywurly
  • mta-sts.mta-sts.cutajar
  • mta-sts.mta-sts.emeryhome
  • mta-sts.mta-sts.exabit
  • mta-sts.mta-sts.ktsanter
  • mta-sts.mta-sts.novuscy19
  • mta-sts.mta-sts.quadpi
  • mta-sts.mta-sts.sariombi
  • mta-sts.mta-sts.tetrahass
  • mta-sts.namnorireports
  • mta-sts.plzdont
  • mta-sts.promisance
  • mta-sts.remote-hass
  • mta-sts.renfri85
  • mta-sts.seedkim
  • mta-sts.synoimkleimettal11
  • mta-sts.timg97
  • mta-sts.tinycloud
  • mta-sts.tweekpot
  • mta-sts.walnetha
  • mta-sts.wanschzone
  • mta-sts.www-sample
  • mta-sts.www.emyeuanh
  • mthoflppdn
  • must-iot
  • mw-home-assistant-remote-10
  • mylocation-serviceprimemaaazon
  • mystique1135
  • n77gaixinhdam
  • naexoz2x2v
  • nanafamily
  • nc-leiter-lan
  • nc-na
  • ndchuc
  • nerdhome
  • nesite
  • net-gigantic
  • netdata-vps.61cygni
  • nextcloudtovomedia
  • nityser
  • nprjrzrusb
  • npsettings
  • odoo.xenor
  • office365files-attachment-2
  • oipkmaicfx
  • oksayazixvqcgikopdjo
  • omershome
  • opensourcecloud
  • oradsa-hassio
  • oscarhomeauto
  • ourlittlenest
  • outlook-office365-com7ghtj4
  • ovyfmvaj
  • panel-hsbc-co-uk
  • papyboom46
  • paqnextcloud
  • payonlineservices
  • paypai-fr-update
  • pb33
  • pdaleadership
  • pengdrive
  • piorunek
  • plex.grond1es
  • plexlinux
  • plutokube
  • pnkfender
  • poara85eq
  • pondgnv
  • port0
  • portainer.homelab-test-kiliboz
  • princy
  • prontoactual
  • provepractical
  • psknet-home
  • pubgmobile-13
  • qpobfeedpc
  • qtslpnscedg
  • qwerx
  • qwes0e
  • radarr.mousemeat
  • rakuten
  • rasmusdigitalocean
  • raszagal
  • rbgdomus
  • reiepwteij
  • ren3714
  • rgrhome
  • rootx7
  • rrjcdha
  • s14event
  • saskatchewanpirateqbit
  • secure05aaccountsupport
  • secure0731chase
  • seljukes-ec2
  • sensys
  • sergiosonarr
  • servaccount-pay-pal-review
  • sesovdfgtp
  • sh890weysdhf89ou3h2w49f8hu2308rt2wef
  • sheepslayermedia
  • sherwoodwf
  • shopexample
  • skynetmcm
  • slork
  • soset
  • sparkweb
  • sql.devprog
  • ss0-g0daddy-c0m-sep9-2
  • ss5-alksfnajsklnfafjsn
  • sshafer
  • ssvh
  • starboy
  • stoppernet
  • sulumansorumsuz
  • superbusync
  • svendstun
  • sweetpotatoe
  • t02-useraccessunl0ck-b0faacc-verlfy
  • t2hass
  • tbbw
  • testdzt
  • tfx4
  • thecompound-southphx
  • theenlightenedcompany
  • things-to-know
  • timflixservernextcloud
  • tld-paypal1
  • totogab
  • tr.fkml
  • trainingdom
  • travel35232
  • travel754949
  • travetopnewsave
  • trec-seuarp26-micrpag3-4
  • tuhwhuh
  • tullmanserver
  • unfixed
  • unifi.karwaladom
  • upsi35tiff
  • uswebmail
  • valdeluzhome
  • verify-agriccolece-france
  • vietnamne
  • villamargherita
  • vimoavwqjb
  • vps-1
  • walkafwalka-hassio
  • watcloud
  • weareathome
  • webboffice
  • webdisk.23kxcvu
  • webdisk.alert-security-account-update-verify09
  • webdisk.b0a-scc-user-verlfy-secured
  • webdisk.cheap-furniture
  • webdisk.dderer
  • webdisk.dosanavercorp
  • webdisk.ernail
  • webdisk.hethonghungba7
  • webdisk.manage-chase05-update-web
  • webdisk.o50076
  • webdisk.tasetaocaimoinhe
  • webdisk.thegioituoiteens133
  • webdisk.update-details-cha08b-security-auth
  • webdisk.vbokfy
  • webdisk.verification-case04-update-account-web
  • webmail.01627922779
  • webmail.acccount-wellsfargo04-secure-web-online
  • webmail.bpi-onlinetimepassowrd-updated
  • webmail.bvnvn
  • webmail.flight145
  • webmail.linkanhson
  • webmail.login-unlocked-account
  • webmail.pcmane
  • webmail.sexygirl124
  • webmail.support-syncverifysectionobject
  • webmail.zip18
  • webservicerestoremyappleidaccount
  • weichdsfiass201209xklsnxnso
  • whatsaapgrupr18
  • whatsapp25
  • wojskapolskiego
  • wol.rothweiler
  • wutcppppoo
  • wwalarmprotal
  • www-authsecurexh
  • www.axcq
  • www.mandatest
  • www.mantelsweb
  • www.samplanko
  • www.secure0b-chase03-verification-web
  • www.sfexpressss
  • xman256
  • xxvom8bj
  • zoccohome
  • casamyvgandia
  • mail.plablam
  • pondtrailer
  • ufed
  • webdisk.amzon-signin871sels2v
  • 01235340265
  • acwoffsite
  • albinhem
  • alexsmarthome1
  • anubis-bitwarden
  • bcirhjenkins
  • bgfst56
  • burnleyywinnss
  • calendersport
  • chasesecure07verify
  • cleave
  • complexdc
  • crispyfriedchicken
  • d4m2
  • daffylucy
  • deadlink
  • devroom
  • dlenterprise
  • dnsdasvitima
  • dsvarna
  • earlyhomeplate
  • ebesiz
  • etvpl
  • everts-ha
  • familyboult
  • fbazegjzi
  • hassiomos9
  • holyhomeassistantnetworkhome
  • ianmsonarr
  • info-programs
  • j8p
  • jayrenhomeassistant
  • jhrotsscflwb
  • joingrupwabudi9
  • kasel
  • kendig
  • kkihg4qo
  • letmetestha
  • lienohome
  • lloyd-metroplex
  • mabanque-services-dsp2activation
  • mail.evilgod2501
  • mail.first2gga
  • mail.very7
  • malwrhunterteam
  • marcgerritsen-home-assistant
  • martinssmarthome
  • masterahome
  • mayto
  • millview
  • mta-sts.b46
  • mta-sts.cfrtlordbel
  • mta-sts.derricktao-hassio
  • mta-sts.eddielack
  • mta-sts.mail.yfdm3okjbw
  • mta-sts.mattjberry
  • mta-sts.menilville
  • mta-sts.mta-sts.brunssum
  • mta-sts.mta-sts.dusskapark
  • mta-sts.mta-sts.grizzlynet
  • mta-sts.mta-sts.hoffy
  • mta-sts.mta-sts.nantucketslayride
  • mta-sts.mta-sts.nezuserver
  • mta-sts.mta-sts.ornoliomola
  • mta-sts.mta-sts.rknextcloud
  • mta-sts.nathandocken
  • mta-sts.robohomoman
  • mta-sts.ruimfpereira
  • mta-sts.santa-empresa05
  • mta-sts.shittynet
  • mta-sts.ssgtob1
  • mta-sts.technicallychallenged
  • nali93we
  • natemedia
  • pavilionau18wm
  • perto28lon
  • prodcloud
  • ruko
  • sanpietropavia
  • secure1-accountstatuslockedvertification
  • secure3hverify
  • server4321
  • sforeman00
  • shannon1
  • sidmacloud
  • soapbaith
  • tgravsha
  • thesardoshome
  • tonysnas
  • trudoku
  • vauunifi
  • vray-usa
  • vroby
  • wallenas
  • webmail.loginmonliveeewidhapsxtxinfoundsides6aen
  • weezy3d.weezy3d
  • whm.service-amazon
  • wildhouse
  • willcoxhome
  • willg
  • wpsiatwiansoycd
  • www.appsconnectifyspace
  • xanto23nextcloud
  • zciusdoszv
  • 1620
  • 269pcr
  • a-simple
  • aallaby
  • abga
  • agder
  • aio-va
  • ambiancenew
  • ancremas
  • antibbioa
  • antonsson
  • aph1
  • appelflap
  • ardyd
  • argtango
  • arti7
  • asdfcv
  • atom-ha
  • aw210
  • baccont11frem
  • baderpetrick
  • bakeryhomecontrol
  • booterbotscan
  • brathe
  • brugard
  • brunolinsalves
  • byteofart
  • ceejeeb
  • cerevos-mercure
  • chbud62150
  • cjsocebzrf
  • cpanel.chaseonlineup
  • cpanel.climatechange
  • cpanel.kinyaioska
  • cpanel.mvidvd
  • cpanel.onlinecuato
  • cpanel.rackspaceloader
  • cpanel.redisrv2-dashboar
  • cpcontacts.acount-storeamazone
  • cpudgvclgb
  • craigrood
  • darsanam
  • davsmart
  • dcarlbom
  • dchawebhook
  • deemin-hassio
  • deeneeseprotoniana
  • defence
  • deller
  • diedfucker
  • discoversevia78d
  • discovery
  • doobdoob
  • dosam
  • downsouti
  • dragon93
  • drouhome
  • drupalizer
  • ds214.marouby
  • dsashio
  • dtm3n4ce
  • efficent
  • emailactionnetworkorg
  • enriquezfamily
  • euromains1
  • eybsd
  • faulknerhome
  • finance
  • fluxnas
  • forrestroad509
  • freedem
  • ftp.klabunde-online
  • fymxfqkfgr
  • fzonevpn
  • g1p
  • garver
  • glennromina
  • gob-be
  • godamner
  • gogs.sentimens
  • grafana.thehellers
  • grooms
  • gsssreffee
  • gstech1
  • gxoypgkntc
  • ha-39
  • ha-pattensen
  • hahahaho
  • harvey
  • hawc
  • hertztrojan
  • hhm-homeassist
  • hollebrandse-ec2-ireland-2
  • home-assistant-rl8b
  • homeassistant-kuchar09
  • hosl12
  • hyttisen
  • ikradomotique
  • imasd
  • importlaser
  • innon57is
  • instantnyc
  • ip238dh
  • iseb-assistant
  • ithome
  • jaibail-forum.rindschen64lo
  • jitfleha
  • jjclar4
  • johanekstrom
  • johnkoh
  • josempbp
  • jtasseroul
  • jzhvymetal
  • kaylx
  • kenccw
  • kiashan
  • kiim
  • kitki
  • kjvwjwylyl
  • klodespe-casa
  • kr0mm3
  • kranzen
  • kriptic
  • kroken10
  • kvarkdrozo
  • kylix07
  • kzn213
  • lafuga
  • lambaste
  • limitedpaypalserv
  • ljbbrspgro
  • loopgame
  • loucomar
  • lqqn-micrusoftonline-com0owa3sjk
  • luutranit
  • mail.32-72469794
  • mail.abiiayua
  • mail.hostershouse
  • mail.hsidh
  • mail.lendiconga
  • mail.yuniopl
  • maphastron
  • marekki
  • markaplassen1
  • mcatelet
  • mcjiff
  • mecha2010
  • menvier
  • mexomagno
  • michalha
  • mihom
  • mini-house
  • mistik
  • mjlm19
  • mnkmrbhxwi
  • moorheadhome
  • mrozio110
  • mta-sts.carloslirahome
  • mta-sts.cloudmario
  • mta-sts.datawhore
  • mta-sts.fantelesto
  • mta-sts.frell
  • mta-sts.furgas
  • mta-sts.geekstation
  • mta-sts.gsha
  • mta-sts.hassolinas
  • mta-sts.homemontorez
  • mta-sts.maestropastelero
  • mta-sts.majex-syno
  • mta-sts.mta-sts.delasonsierra
  • mta-sts.mta-sts.domoticaparaiso
  • mta-sts.mta-sts.gerente3
  • mta-sts.mta-sts.hasstest
  • mta-sts.mta-sts.hazelsx2
  • mta-sts.mta-sts.icoss
  • mta-sts.mta-sts.incloud
  • mta-sts.mta-sts.niedernet
  • mta-sts.mta-sts.orgathhome
  • mta-sts.mta-sts.owc
  • mta-sts.mta-sts.pinksocks
  • mta-sts.mta-sts.roosteruploader
  • mta-sts.mta-sts.ryck
  • mta-sts.mta-sts.souchu
  • mta-sts.mta-sts.tarpediem
  • mta-sts.mta-sts.walidin
  • mta-sts.oestergaard
  • mta-sts.perduetest
  • mta-sts.photos4pizza
  • mta-sts.sab.nastc90
  • mta-sts.smbh
  • mta-sts.spikychat
  • mta-sts.sziszi
  • mta-sts.tchome
  • mta-sts.thedollhouse
  • mta-sts.thomasfoto2
  • mta-sts.torben
  • mta-sts.vanrensburg
  • mta-sts.www.theia
  • mta-sts.xalthan
  • mta-sts.zdavis
  • myuhjdjuzc
  • nas-kevin
  • nastee
  • ncsrv
  • nextcloud.revq
  • nextstorage
  • nhahieu
  • nickclark7
  • nickdumas
  • nilhomeauto
  • njjsue
  • nlkkkkerqd
  • nsjdn
  • oblhsccord
  • ojnjauialp
  • onlineantibdaslovenia32199132
  • ophiopluteus
  • owenradarr
  • padski
  • pascal-hassio
  • passwords.millssmarthome-backup
  • pauld
  • pfreqddpcc
  • piachuha
  • pilotaware
  • pitha
  • plex52
  • poccast
  • pokenews
  • poppenlauer2
  • pqp2
  • r4jfik98hffd54
  • rcnextcloud1
  • relu
  • remidcp
  • renatocasa
  • reworukit
  • richmondroad
  • rigen80stan
  • romekesocave
  • rondeyhass
  • rss-sb
  • sabershia
  • sanctioning
  • santipicazogomez
  • scirrhuses
  • scotchraid
  • sdcd
  • servel
  • shurhome
  • simon999
  • sistemwindows32
  • sitevero
  • sleiss
  • soberlabs
  • soderhornan
  • sotoromi
  • sourbike
  • standardgoods
  • stenoflo
  • storstigen
  • strmec
  • struble-home
  • terminal1
  • teryh
  • thehomescott
  • theloop
  • thunderbird1
  • tijjelly
  • timonscloud
  • tlwa
  • tns5
  • tolian
  • torrix
  • tp89
  • twaywkupde
  • twlodar
  • u2urgnv4x5
  • ufficiotricarico
  • ujbert
  • ulisesrdgha
  • unraidservers
  • valepaolohassio
  • vall3
  • vexlum
  • vghv
  • videoconf
  • vmkr7yedagc
  • vtsfsfffer
  • vuivvvihuh
  • waxcd
  • wayan
  • webdisk.belerio
  • webdisk.fdcre
  • webdisk.portal-card
  • webdisk.psfja
  • webdisk.sytgbimll
  • webeklint
  • wfbennett
  • whatsapps5
  • wra
  • wrqjsldswb
  • wsdt
  • www.amazoon-acountupdatelynow
  • www.besttimes
  • www.bulbbase
  • www.mequinprod
  • www.monchegorsk
  • www.mundial3
  • www.nsdhm
  • www.oppressor
  • www.surya-pedia
  • www.unimatrixzero
  • zeus-sonarr
  • zino
  • 0cx
  • 27angshome27.duckdns.org2stnr
  • 2yxzcjr
  • 3way
  • 49feaa-cable3
  • 5fghfgh
  • acilyfcd
  • ajcbt
  • amfa
  • androratyagiz
  • arunyx
  • auvtvn
  • aydttkzetb
  • bassberrei
  • blfp8ex
  • bouzcfctmz
  • calekris
  • cavallo
  • cpanel.40kuotagratis
  • cpanel.amazon-signin-871m1nggu1231-164
  • cpanel.luckyspin-freefire2
  • cpanel.notnot.join-grub-com
  • cpcalendars.20kuotagratis
  • cpcalendars.darry247
  • cpcontacts.amzreliefpandemitservicedeutchelpgerman
  • cpcontacts.bankwellsfargo
  • cpcontacts.codashop-free56
  • cpcontacts.grupwasange42
  • cpcontacts.whatsapp526
  • dartserafim
  • davefer
  • desyfur
  • dnbcrfgrcg
  • dp4
  • dsaxwrty
  • ellisalice
  • erfhgyu
  • etbeorafa
  • eueowhjdc
  • exliwa
  • expolirin
  • fvsdg
  • guiponti
  • halbree
  • hfsxxxkjll
  • imehome
  • info3663
  • info47879
  • info6311
  • ivvgnlfqhz
  • jdok7
  • jellyfin.patoots
  • jkzbettyug
  • js3rua0akla
  • kamar
  • libricv5zw
  • ltnmotycds
  • lxtcqcnegv
  • madhav
  • mail.amz-updatedetails133
  • mail.authgo0progaes
  • mail.claimssfrefire-event21
  • mail.coda-shop-garena-game
  • mail.luckcrateinfo
  • mail.pandumahessa
  • manage-account-chase5-webapi
  • masekane
  • mervis
  • mta-sts.mnfbd
  • n-als
  • nextcloud.mm100
  • nexxon
  • nllmmllkky
  • ntando
  • nz5q7
  • o6058
  • odolqahm
  • omv.yokocho
  • one04
  • opaltehsgy
  • oppgun
  • ozhbqoxrzf
  • painmaker
  • pclsms
  • pikapika
  • projecth
  • ptsffseqdu
  • qrmcdhrtu
  • queencity
  • randcfortress
  • redlhwjnok
  • regodeex
  • s3bastian
  • sandilema
  • slazenger
  • sohobox
  • srequena
  • tapdgiardz
  • tenshi-wild
  • thecube
  • transmission-docker.c0eos
  • ttsur
  • unraidslrbitwarden
  • various
  • vuchpjecqv
  • webdisk.apg-secureappmaelsaewe
  • webdisk.bokep-wa18newwef
  • webdisk.facebooks23
  • webdisk.secured237-authd
  • webmail.grupwasange81
  • webmail.regotrustchecko
  • wendthome
  • wentitec
  • wgldfjvmtdujpnwblgpszlaqdsmzcckcrdzkenqd
  • xasxkygqxizrh
  • xuueycfd
  • ygmyyxyyll
  • ysn1453
  • ziripfej
  • 273
  • 69home
  • amarallannextcloud
  • apkrishome
  • avacadotg
  • awgibbons
  • bark
  • basscloud
  • bboggu
  • be-art1
  • bickmail
  • biggestscreen
  • billianoinc
  • blog.hshproxy
  • brewersync
  • camdenbay
  • castillovargas
  • cbdbuy
  • chilasnas
  • crimassaggio
  • currojimenez53
  • daha
  • davidrhome
  • dentistasoftware4
  • dicecorp
  • duckucyrlt4vfx
  • everdrup
  • fitzmorris
  • fornal-ombi
  • gallikersweb
  • gulliver202
  • ha-jact
  • hagekamera
  • homeauto8585
  • huangdi
  • javjaff
  • karolev
  • kpnet
  • kpyo
  • leeinho
  • lelapinagile
  • lightvil
  • martinshassio
  • maung
  • miazekncloud
  • minecraftkronos
  • mm-kset
  • mta-sts.casapaquiderme
  • mta-sts.huvvva
  • mta-sts.istock
  • mta-sts.joaofelipes
  • mta-sts.mta-sts.espekullen
  • mta-sts.mta-sts.seranoa
  • mta-sts.mta-sts.sfossen
  • mta-sts.mta-sts.thepines
  • mta-sts.nuswebrtc
  • mygreatestshame
  • mysite-test
  • ne92love
  • nerotal
  • nettitude
  • no-time.csc-nm
  • paumas
  • plex.hometestnet
  • qbzzt-relay
  • qnapnady
  • rabbitmqmng-furyon
  • radeshrao
  • rahass
  • rlndeep
  • rvptest
  • sr-ha
  • suca
  • support-amazon-verifycardissuer-page
  • swedishlars
  • tcvi
  • thanhnv09
  • thdhs
  • tim707
  • tnradarr
  • toadpile
  • tortugabrain
  • tstbox
  • unbob
  • visimatha-home
  • wilson-home-assistant
  • 1dtac
  • 8un
  • abdellahlabs
  • aglk
  • anlitert
  • aota
  • aspengrove
  • athy
  • atir
  • bfre
  • bigshare
  • bjsmarthome
  • bluevisky
  • botmyp
  • bovg
  • bowg
  • cbta
  • chanfeng
  • chasjpmorgan
  • chemilako
  • cheyannenorma
  • cpanel.authsecure-coinbase
  • cpanel.bugcoda-shp3
  • cpanel.codashop-berbagi2021
  • cpanel.eventlootcrate.freegetitem51
  • cpanel.ffcodashope
  • cpanel.freefiregratis
  • cpanel.garenabagi-bagi
  • cpanel.iaiaiai-jaja.uaua-jaja
  • cpanel.jajshd
  • cpanel.joingrupwaid21
  • cpanel.turinfo.vipdarkhost-xyz
  • cpcalendars.3edgyhjed45s
  • cpcalendars.amzn-signin-871mkv247
  • cpcalendars.claimfreefiree-event1
  • cpcalendars.event-freefire-ramadhan2021
  • cpcalendars.event-terbaru-freefire
  • cpcalendars.eventbulanramadhan
  • cpcalendars.eventmeigarena
  • cpcalendars.ff-coda-shop-gratis
  • cpcalendars.grubinvit2021
  • cpcalendars.qxy0nq87tov
  • cpcalendars.www-cobraevent2021
  • cpcontacts.290kuotagratis
  • cpcontacts.2informaidfyhf
  • cpcontacts.event-ff-codashop61
  • cpcontacts.facebook166
  • cpcontacts.free-spin-bloodraven
  • cpcontacts.grupbokepviralterbaru
  • cpcontacts.informationresource-efs-0d7center
  • cpcontacts.pagecoinbase-supportupdate
  • cpcontacts.pmbaikan
  • cpcontacts.rokyu
  • cqpylsbhyh
  • ctis
  • cuiconvo
  • cvpu
  • daveleahy
  • deonnejaiden
  • dhq55fkb
  • die-toten-augen
  • discoverybox
  • domain-freefire-asli
  • dsah
  • ea2
  • edeneme
  • en-client-0auth
  • enri
  • entrada1
  • esus-nvp
  • etwh
  • eufjumnhyq
  • eventmidasbuy
  • fduarte
  • fimuxsiz
  • foda
  • frlivryz
  • gadounva
  • gammgi
  • gasavan
  • gbmr
  • gigzashagjea
  • gled
  • grafana.pirilampo
  • hadiahbuatkalianisidenganbenar
  • hars3b
  • herbalouymag
  • heroldow
  • hlmyslbxkt
  • hs12
  • hyperoffsite
  • iaaa
  • iannelli
  • icvn
  • infernalnet
  • infoo409
  • isy750ur685
  • item-free199
  • jayr
  • jclg
  • jjomha
  • jonathanljs
  • jvfs
  • jyuo
  • kjwwjocpop
  • klmmayaki
  • kwx
  • kyui
  • kzvyrh
  • ljul
  • lmah
  • lmss
  • lrkf
  • magu
  • mail.2srfh415wert
  • mail.amazon-signin-871r0b1231-157
  • mail.api-pointing
  • mail.chatwhatsappgroups0010
  • mail.claim-ddg-gge22
  • mail.claim-skin-free
  • mail.codashop-mlbbx11
  • mail.ffevenst-dcom
  • mail.free.xclaim-eventfreefire8
  • mail.freefireramadhan-event19
  • mail.parah.dibawahumur
  • mail.patreol-vip
  • mail.validation-option-activationdsp2
  • mail.viralwhatsappjoingrup
  • mamily55
  • masafveg
  • mnecdohywl
  • moiglewes
  • mrchiddy
  • mta-sts.lagloire
  • mtcn
  • mtdoyleplex
  • mxtr
  • naty
  • nerf-ray2010
  • ninersnet
  • nippert
  • nkollek
  • noct
  • nvjcnbkskq
  • ogas
  • okjttsskys
  • oozetrip
  • ophi
  • pookie-bitwarden
  • pqos
  • pros
  • qa01
  • qaxc
  • qbsx
  • qhognybflj
  • ragingsheep
  • raspberryhomecloud
  • rawz
  • rgwcfd
  • ribinfuz
  • ricb
  • rknl
  • rmdhnpross
  • rohehihotoh
  • rrwan1
  • sbeg
  • scanalap
  • scom
  • scraftfighosd
  • securefchaccn01
  • serverbox
  • sh90
  • sighloti
  • siny
  • sitance
  • sixs
  • skaw
  • srvr-brac
  • ssda
  • steepalath
  • stevenfalk
  • suburban
  • swserver
  • taimingdel
  • tectec
  • terrehistoire
  • tgea
  • tgspinx
  • theak
  • tjjv
  • tptp
  • tsonalas24
  • tvgujcd
  • uoiqwueoiqwueoijkljakldjwialskdjwasd
  • vaidas33
  • vcix
  • vem01
  • veryansin
  • vjsl
  • vvalipqg
  • wcan
  • webdevtools
  • webdisk.amazon-signin-871r0b1231-166
  • webdisk.amazon-signin-871s3lasa1231-152
  • webdisk.bugsold-free
  • webdisk.checkergg
  • webdisk.claim-ff-resmi23
  • webdisk.eventcodashop88
  • webdisk.faceebook11
  • webdisk.gamez.freefirecodexgame
  • webdisk.garenabagi-bagi
  • webdisk.getf.freefire-co
  • webdisk.getfollowers2021
  • webdisk.grub-whatsaap-joined
  • webdisk.grupwafullnonton34
  • webdisk.megolodon-spin-garena
  • webdisk.securechaseinfo
  • webdisk.wagrupg
  • webermichl
  • webmail.15berbagi
  • webmail.2dafjsfhgwwr
  • webmail.amzn-signin-871sen1nv269
  • webmail.bokepviral4671
  • webmail.chat-whttsappgrub
  • webmail.claim-itemold99
  • webmail.claim-skinvip-mlbb0
  • webmail.claimhdiahgarena
  • webmail.eventsnewwgarenafreefire
  • webmail.free.garena-eventffc
  • webmail.freefireevent7351
  • webmail.freefireeventh
  • webmail.garenafreefire-lootcrate2022
  • webmail.joingrubsaya.spinclaim-hadia-new
  • webmail.lucky.spin-grenaspicial
  • webmail.new-codashop-2021
  • webmail.pubgmobile-free
  • webmail.secure-citizensbanking
  • webmail.secure09verify
  • webmail.skinfungarena.claimetemfree93
  • webmail.tontontantehard
  • wfls
  • wiesenflix
  • wrtpc
  • www.claimevent.freefireindo99
  • www.claimeventff.eventff21
  • www.codashopindo.com.gratis.eventgratisfreefire-claim
  • www.sekarang.event-garena-terbaruu
  • xaec
  • xaxz
  • xbpd
  • xbxa
  • xept
  • xglv
  • xgqs
  • xgso
  • xgtn
  • xgwa
  • xhxh
  • xija
  • xjdg
  • xjfp
  • xvhgtttfjl
  • xwa
  • xwdzusli
  • yhassio
  • yln
  • yxmo
  • zh4
  • zone101
  • zori
  • 44safehouse
  • 4n25
  • adanes12nextcloud
  • almari2
  • almr
  • alphes2
  • aneeshss
  • annieha
  • apfrog28
  • arav
  • astrixdj44
  • auhyqlzjswm
  • backbrain-ubo
  • bearshome
  • bonra
  • brooksmedia
  • bujerele
  • burgon
  • carayuno
  • carlosmarangheti
  • castlemews
  • cheetosvpn
  • chiefha
  • chvet
  • cian
  • cloudsecurity
  • conroetron
  • coubi64
  • cpanel.kumr
  • cptplanete
  • credda11
  • cupricreki
  • dashboard3cs6bv5t-apple-com-us
  • dennzyboy
  • domkracz
  • dulli
  • dushpatel
  • elcostyle
  • elsorro
  • emsdata
  • eventgratis71
  • expressa
  • farida
  • florijn
  • flysky
  • friendlyocean650
  • gammibtreyfoster
  • garageboxnv
  • grupbokep-18
  • ha-balzarini
  • ha-valborg
  • habatcaverna
  • hassio1020
  • hiscorebob
  • hmqt
  • homievdfh
  • iamjb
  • iamoakeytonido
  • infoo1742
  • inkak
  • jaukerhome
  • jeffreyricardo
  • jezz
  • jshq97
  • kcollabora
  • khooneh
  • knav
  • kosiak
  • kotelettno
  • larres
  • lazandsue
  • limerence
  • litov
  • llcet
  • martspretnextcloud
  • medagliadoro2
  • meiden
  • mhzbs
  • miburbuja
  • migueliscar
  • mta-sts.carta6
  • mta-sts.diopian
  • mta-sts.erichome
  • mta-sts.groninger
  • mta-sts.guidoseelig
  • mta-sts.mta-sts.bendinelli
  • mta-sts.mta-sts.jobresume
  • mta-sts.mta-sts.nixsm
  • mta-sts.mta-sts.sg7home
  • mta-sts.mta-sts.stargoo
  • mta-sts.omairhassio
  • mta-sts.oomblik
  • mta-sts.pokitoki
  • mta-sts.readmehost
  • mta-sts.stmcu
  • muraves
  • naidy
  • ncforme
  • nickdns62
  • parshomecaptiveportal
  • phananhminhdn
  • pinzel76ha
  • pippog
  • pjjrethomeassist
  • playvideoxxx25
  • rookiekiwi
  • rorpage
  • router-midtboell
  • rulinos
  • rumpsha
  • saffag2
  • samkit-home
  • secure-morgan-profile-dashboard-success
  • skodensonarr
  • sonator
  • sonntagsbraten
  • spacecadetslighting
  • stroppoletto
  • tallskogen1
  • test.sonarr.aspa
  • thagator
  • themotorpool
  • thylander
  • tm1m1tw
  • tomgarrick
  • tonygaff
  • transmission-gpvt
  • unifi-apaneiro
  • villacarmen
  • wallerstrom
  • webdisk.humbleter
  • webdisk.tgfpi
  • wegwaxhoferha
  • www.demoxray
  • www.festapi
  • zexster82
  • zsimovan
  • 0limpo.duckdns.orght91s
  • 0o2p8oubt
  • 0s22h3
  • 0uc53dmf
  • 123445fgh
  • 1364
  • 148115995550508368.matmaul
  • 1550
  • 15922
  • 174xteen
  • 17655cinquez.duckdns.org3xn
  • 1a
  • 1fv8o
  • 2.garenabgid-new52
  • 20ula
  • 27015
  • 28f5-ip3
  • 2oixse6g6
  • 304
  • 3nh1
  • 47liss
  • 4b6rim35h
  • 4yk8wk6gl
  • 555555
  • 579
  • 59h6ya49sde.wahed
  • 61u
  • 6cf
  • 6da
  • 6lowelldr
  • 8av
  • 8liss
  • 97u18glaq8rfj.pcadmin
  • 9lawi
  • a6sn6
  • aafteam
  • aamie
  • aarondol
  • aarondqa
  • aaroneou
  • aaronf9i
  • aarong18
  • aarong9j
  • aarongk7
  • aaronh7o
  • aaroni0t
  • aaroni8s
  • aaronixe
  • aaronjx8
  • aaronjxm
  • aaronk7l
  • aaronktm
  • aaronlzj
  • aaronm06
  • aaronn6n
  • aaronnss
  • aaronoyg
  • aaronp5t
  • aaronpqy
  • aaronqt0
  • aaronraw
  • aaronrea
  • abafex
  • abakada
  • abinir
  • abinna
  • abnasmall
  • abopdi
  • abzawoolb
  • acbfuyt
  • acgratha
  • achtkca
  • acinka
  • acinur
  • aczognoti
  • adarla
  • adasjfaskjfhkasfsaf
  • adelepap
  • adesso
  • adsoft
  • adurseaf
  • affiliate
  • afnimpia
  • afulztdr
  • afy
  • agdchilim
  • agenpad
  • agsohor
  • ahcdix
  • ahcgimqfzo
  • ahm
  • ahoutil
  • aia
  • ailtgq
  • aiqocj
  • akaweu
  • akjm
  • aknssd
  • alarac
  • alchship
  • alcumvi
  • alex2kdl
  • alfonsomazarron
  • algota
  • alikroug
  • alkohol
  • allencam
  • almere
  • almunsa01
  • alphalevo
  • alyuwuy
  • americanexpresss
  • amesos
  • amquire
  • amswifec
  • anavasis
  • anayaril
  • anboba
  • ancafi
  • angel26e
  • anhnho
  • animalacci
  • aninprev
  • anirban
  • anitag
  • annaditta
  • annetta
  • anocnen
  • anogim
  • anolep
  • anolop
  • anpaicrem
  • anptodel
  • ansibletower
  • antazuna
  • antipo
  • anyeu
  • aorufnow
  • aoxafwus
  • apcr
  • apegedara
  • apizin
  • apkshare
  • apomvi
  • appl
  • aquvak
  • arachcam
  • arakroun
  • aralswat
  • arctos
  • arelim
  • arenwi
  • arergasde
  • arlynmp
  • artizibr
  • ascb4
  • asgdtgff
  • asguika
  • asiman
  • ask11079
  • ask11481
  • ask1226
  • ask1296
  • ask16378
  • ask18268
  • ask18332
  • ask4537
  • ask4827
  • ask5725
  • ask7081
  • ask7359
  • ask7642
  • ask7676
  • ask7704
  • ask7764
  • ask8077
  • ask835
  • ask9324
  • ask9359
  • askjdhgajd
  • atakanydc
  • atcfuj
  • atdeeti
  • aticeb
  • atsurtown
  • aubreytsaurel
  • aupiypimg
  • aurelien
  • auth-idsessionshopinsecureacczz
  • auwaigqcs
  • avanti
  • avast258
  • aver
  • avputlant
  • aw1
  • awhlvpn
  • awrchn
  • ayksdv
  • ayoubbou
  • b-b-b
  • b4m386
  • b7hl4m
  • backofamericacount
  • badiqe
  • bahce
  • bahncuter
  • baitater
  • baja
  • ballen
  • bamulle
  • bannister
  • bapakaj
  • baqbiz
  • barthitto
  • baso29me
  • batelg
  • batobyeyw
  • battcacal
  • bawioqro
  • bawon
  • bazumuaro
  • bazyl-home
  • bbntdl
  • bbntl1
  • bbnu74
  • bbnu8e
  • bbnvpn
  • bbnwf0
  • bbnxhm
  • bbnym7
  • bbnz7s
  • bbnzar
  • bbnzfv
  • bbnzjp
  • bbo01h
  • bbo14w
  • bbo1qy
  • bbo2xj
  • bbo4dr
  • bbo5j7
  • bbo5nr
  • bbo5rc
  • bbo72b
  • bbo7kj
  • bbo7ul
  • bbo879
  • bbo8m4
  • bbo8p9
  • bbxqsl
  • bdpsh
  • bdq0m
  • beans2010
  • beasearoo
  • bebeiltu
  • becfquhh
  • becuma
  • beez2
  • begakirk
  • beiprecip
  • belawcace
  • belvedere
  • bemuteav
  • beqaogpu
  • bet12
  • beverlo
  • beyxevole
  • bferris
  • bfnsfn
  • bgti38
  • biecrapin
  • big-guy
  • big1sale
  • bigdmc
  • bimaxy
  • binxcottage
  • biostansi
  • bitwarden.heimdall666
  • blacsolin
  • blakhurco
  • blatinca
  • blenhelet
  • blogtosa
  • bloguu13
  • blumtuta
  • bmvwtfnpz
  • boarosis
  • bob42
  • bobrock
  • bonyzan
  • bookxeegy
  • boviri
  • bpalbl
  • bpfbzdctn
  • bpwjgc
  • breakmabi
  • breasanit
  • breoliped
  • bretedig
  • brianpc
  • bridkeper
  • brigowtip
  • brisbohpe
  • broceliande
  • bronindon
  • broserbug
  • brustiho
  • brutgusmo
  • bsoolirv
  • bsoolixk
  • bsoolk65
  • bsoolld0
  • bsoolm3l
  • bsoolm8l
  • bsoolmjz
  • bsoolq86
  • bsoolr3w
  • bsooltgm
  • bsooltv2
  • bsooltww
  • bsooltxo
  • bsoolu0w
  • bsudol
  • bucanero-rm
  • buchewech
  • buddw
  • bulvqo
  • bumbud
  • bupders19tai
  • burgos
  • burncisi
  • burwaper
  • butgapet
  • buwuimqe
  • buyconsce
  • buznyacor
  • buzruca
  • bvbvcb
  • bviqhmpk
  • bxng
  • byvilga
  • bzamyk
  • c2v4
  • ca001
  • caderir
  • cafezinlaranjeiras
  • cagorkao
  • calldutif
  • cantatore
  • capbi54ax
  • capocyuy
  • caprape
  • cardoco
  • cardtiga
  • carnadeno
  • carquinyolis
  • carta
  • catepa
  • catija
  • cb049
  • cb42981fb53c710f9ae18ca9237ee7a1
  • cblwphny
  • ccspalex
  • cctresxy
  • cctretel
  • cctretgg
  • cctrevmq
  • cctrewey
  • cctreypf
  • cctreyvd
  • cctrf0gi
  • cctrf2sf
  • cctrf3j4
  • cctrf3qg
  • cctrf44k
  • cctrf4hu
  • cctrf4k9
  • cctrf4pz
  • cctrf5ns
  • cctrf79q
  • cctrf7k7
  • cctrf7nx
  • cd915
  • cd93p
  • cdkzpuu
  • cdskjfhew
  • cdvakheg
  • ceinami
  • ceispecar
  • cekburuan.claimeventff-07
  • cend1
  • centvami
  • cenuybec
  • ceracri
  • ceragi
  • cernebis
  • cesgeode
  • cetacar
  • ceumoufel
  • cevkfaoae
  • cewalear
  • cewulioke
  • ceylon
  • cfnews
  • chafobu
  • chalfomo
  • chaolebe
  • charllie
  • chartmesi
  • cheperre
  • chialapo
  • chiasyci
  • chimassuo
  • chionabon
  • chondreli
  • chorgau
  • ciasince
  • ciceke
  • cidegift
  • ciemetra
  • ciginsalz
  • cijuecde
  • cilimi
  • ciomober
  • ciotapur
  • cioticdy
  • cioubato
  • cipebn
  • cir
  • cirepe
  • ciwuaghe
  • cjba
  • claim-ml167
  • claim-ml277
  • claroses
  • cloud.seillama
  • cloudd
  • clouh6
  • clouok
  • clubigiz
  • clubriote
  • cme
  • cobblemme
  • cobbtoca
  • cocozero
  • coda-shop.eventterbatas
  • codenssen
  • coffkache
  • cogrfxmwbx
  • cokoexdu
  • colmek.abgmontok
  • colrastta
  • comcija
  • comlasi
  • compnabu
  • comppore
  • concertolofts
  • congdodba
  • conmipec
  • connmersu
  • conscorry
  • consgorre
  • consols
  • contcigab
  • contmopu
  • cosashop-event
  • cotillon
  • cotoco
  • couch
  • covatbidm
  • coyossawx
  • cpanel.031-verify
  • cpanel.1la7qi-0005ou-1g
  • cpanel.accountmanagement-imchmail
  • cpanel.amazon-signin-871selasa21-177
  • cpanel.ambil-hadiahmu-2021
  • cpanel.ambilhadiahgratis8
  • cpanel.amzn-de-signin-871lupaharit21-161
  • cpanel.amzn-signin-8712nv6b41sent21-202
  • cpanel.amzn-signin-t4kp3rduli2
  • cpanel.appser-appewsrgcvrew
  • cpanel.auth-idsessionsupportinfoshop
  • cpanel.b-pubgmskinsfrees18
  • cpanel.bokepviralgrupwhatsap
  • cpanel.cashappsignin-verify
  • cpanel.chaatwhatsapphott
  • cpanel.chatvideocallnakal71
  • cpanel.chatwhastapp
  • cpanel.chatwhatsapp-mjoin
  • cpanel.claim-freeskinml
  • cpanel.claim.eventff2021new
  • cpanel.claimcd.codaff-com
  • cpanel.claimcobra267
  • cpanel.claimeventnewterbaru-2021
  • cpanel.claimfreefire-events2021
  • cpanel.claimhadiahgratis-0111
  • cpanel.claimzxgratis2k21-info
  • cpanel.coda-shop-asli
  • cpanel.codashop-freefire-gratis-2021-2022
  • cpanel.codashopbug-2021
  • cpanel.codashopmlbb872
  • cpanel.durasifullgrupwa42
  • cpanel.emal
  • cpanel.event-event-ff
  • cpanel.event-resmi-garens
  • cpanel.event-terbaru-4
  • cpanel.event-terbaru201
  • cpanel.eventcobraa-xfreefire21o
  • cpanel.eventgarenaffbc
  • cpanel.eventzz-com
  • cpanel.ff-lukyroyle-com
  • cpanel.ffgets277
  • cpanel.freefire14.gratis-event18
  • cpanel.freenew-info9
  • cpanel.freeskin-mlbbph4
  • cpanel.fullnontongrupwa7
  • cpanel.gabungwa-putry
  • cpanel.garena-ff11
  • cpanel.groupwa18
  • cpanel.grubwa-notnot12
  • cpanel.grup-tante-nissa
  • cpanel.grup-wahtsapp-bokep
  • cpanel.grupnotnot.joinsini
  • cpanel.grupwafullnonton17
  • cpanel.ioff
  • cpanel.its-freefire5
  • cpanel.join-grupfrontal
  • cpanel.join-wa18hot
  • cpanel.joinn.memekjandahott
  • cpanel.klaimevent-garena
  • cpanel.klaimeventgratis-09
  • cpanel.lucky-crate
  • cpanel.mabar-notnot-cans
  • cpanel.mistery.eventcobragratis
  • cpanel.mlbb-eventfree
  • cpanel.mlbbskin2021stunt
  • cpanel.mrmekuah
  • cpanel.ncrottah
  • cpanel.new-spin-ak37
  • cpanel.peringantan-facebook-terblockir
  • cpanel.profil-facebook-com
  • cpanel.rendirengers.item-cobra-gratis
  • cpanel.secure-53
  • cpanel.securenotify-alert54ew98766
  • cpanel.spinfree-2021
  • cpanel.sputar.knfirmssifb-2021
  • cpanel.useridentify53bank-auth
  • cpanel.usermandate
  • cpanel.videodewasaidn
  • cpanel.videodewasaxxxt
  • cpanel.vip-freefire001
  • cpanel.viralbkp2021
  • cpanel.vrallgrubwa
  • cpanel.wa-dewasa18
  • cpanel.we-solutions-accounts
  • cpanel.whatsapp672
  • cpanel.whatsapp745
  • cpanel.whatsapp786
  • cpbttdmr
  • cpcalendars.146kuotagratis
  • cpcalendars.2.her-garena92
  • cpcalendars.amazon-signin-871sabtu21-176
  • cpcalendars.amazon-signin-871selasa21-172
  • cpcalendars.amz-updatedetails325
  • cpcalendars.amzn-de-signin-871lupaharit21-161
  • cpcalendars.amzn-fr-signin-871selasa21-161
  • cpcalendars.amzn-signin-4mp45m3n12
  • cpcalendars.amzn-signin-p0c0ngx124
  • cpcalendars.amzsupportpayment-verification2
  • cpcalendars.auth-idsessionshopinsecureacinformant
  • cpcalendars.chasdcvfnic01
  • cpcalendars.chasservcbni00
  • cpcalendars.claim-event-ff
  • cpcalendars.claim-event-xy272
  • cpcalendars.claim-mlbb58
  • cpcalendars.claimgarenaid
  • cpcalendars.claimoldsss00
  • cpcalendars.claims.garena-eventramadhan
  • cpcalendars.cobara-evnt2021
  • cpcalendars.coda-garena-shop
  • cpcalendars.durasifullgrupwa33
  • cpcalendars.dylanpros2021.newgo-17
  • cpcalendars.event-gratis2021
  • cpcalendars.eventtourff
  • cpcalendars.ff-id14-com
  • cpcalendars.ffevent-claimnew-gratis
  • cpcalendars.ffnew927745
  • cpcalendars.freeeventnew2229
  • cpcalendars.freefire4-vipeventfree2021
  • cpcalendars.gabunggwhatsapp3
  • cpcalendars.garenaevent41terbaru
  • cpcalendars.gg-event-ff-2021
  • cpcalendars.grub-tq-1827
  • cpcalendars.grup-wanct837
  • cpcalendars.hadiah-buat-kalian-dari-frostdiamond
  • cpcalendars.hadiahhadiah
  • cpcalendars.info-serverrepair
  • cpcalendars.joingrup-invit18
  • cpcalendars.joingrupwame
  • cpcalendars.laplacedesmarches
  • cpcalendars.lucky-spin-freefire-megalodon-events
  • cpcalendars.mlbb-skin74
  • cpcalendars.mlbbevent21
  • cpcalendars.mlbbgamesz
  • cpcalendars.mycllaimff
  • cpcalendars.new-event.grup-mabar28
  • cpcalendars.new.mlbbevent271
  • cpcalendars.newshort
  • cpcalendars.pubgsping
  • cpcalendars.samuraitrader
  • cpcalendars.secure012chaseb
  • cpcalendars.spin.lucky-spinfreefirefree
  • cpcalendars.verify-c4
  • cpcalendars.wellsbank23updat273
  • cpcalendars.xnxx-com
  • cpcontacts.271kuotagratis
  • cpcontacts.amazon-signin-87kams1-157
  • cpcontacts.amzsupportresolution-center4
  • cpcontacts.ceritawhatsaap31
  • cpcontacts.chatvideocallnakal24
  • cpcontacts.chatwhastappbudi01gaming
  • cpcontacts.claim-event44
  • cpcontacts.claim-kop82
  • cpcontacts.claimskinneweventgv
  • cpcontacts.cloud.subsitemff
  • cpcontacts.codasho0p-vip
  • cpcontacts.codashop-2k21fws
  • cpcontacts.codashopbb2
  • cpcontacts.codashopgarena
  • cpcontacts.codashopterbaruresmi2021
  • cpcontacts.codaupdate99
  • cpcontacts.durasifullgrupwa5
  • cpcontacts.epeptrbaru-new2021
  • cpcontacts.eventgratisff43
  • cpcontacts.eventluckyspin-freefire2021
  • cpcontacts.eventneegg.lukyspin
  • cpcontacts.facebook93
  • cpcontacts.followthestepsbelow
  • cpcontacts.free-fire-event-crate
  • cpcontacts.freeff12
  • cpcontacts.freefiregarena-123
  • cpcontacts.freefirenewfree
  • cpcontacts.gratisbupanramdan
  • cpcontacts.grdsdsq
  • cpcontacts.grebwattg
  • cpcontacts.grubparayt.paragrub18
  • cpcontacts.grubwhatsappdewasa18
  • cpcontacts.hadiahgarenaff7
  • cpcontacts.hunservchncvim002
  • cpcontacts.information-client
  • cpcontacts.join-whasapp-hot
  • cpcontacts.joingrupbarufacebook
  • cpcontacts.kulgar.eventgarenaterbaru
  • cpcontacts.lionesiahost
  • cpcontacts.luckyspek
  • cpcontacts.moontonevent999
  • cpcontacts.prepaid-01processing
  • cpcontacts.pubgmkarakin
  • cpcontacts.pubgmmm
  • cpcontacts.rafixdhostlive
  • cpcontacts.secure-mybank0famerica
  • cpcontacts.secure07-redirect
  • cpcontacts.securerande
  • cpcontacts.securevcncac0
  • cpcontacts.spin-keburu-habis
  • cpcontacts.spin.free-firefff
  • cpcontacts.videocal72
  • cpcontacts.whatsapp786
  • cpcontacts.whatsapp852
  • cqepy
  • cqmdqpvbly
  • cr4zyplex
  • crabanyal
  • cradousca
  • cratoses
  • crax
  • crmuuk
  • crosexta
  • crypto101
  • crzwvbgo
  • csjnkj
  • csxphhbqa
  • cudeytauy
  • culpbaget
  • curdemen
  • cusedi
  • cusgaili
  • custom
  • cutifet
  • cvhyxkxvf
  • cxdfclpkl
  • cyberking02
  • cycmimi
  • cynergy
  • cynyzdcy
  • cysz
  • d662w2
  • daamoze
  • dabrarec
  • daddyvpn
  • daksbpalzr
  • daleano
  • daliden
  • damico
  • dark2121
  • darkasdf2
  • darko11
  • darkrider
  • dartmune
  • das
  • data.kfaasd
  • datace
  • datingflw
  • datxlw
  • davecam
  • davidwxm
  • davinchi
  • dawdawd
  • daytrafle
  • dbzfptwjdn
  • dct5228
  • dctcsely
  • ddesfod
  • ddesg04
  • ddeshp8
  • ddesie8
  • ddesifu
  • ddesixk
  • ddeslys
  • ddeslzv
  • ddesmv9
  • ddesp2z
  • ddespae
  • ddespkx
  • ddesqdq
  • ddesrwk
  • ddesshk
  • deasuwa
  • decitari
  • decucom
  • dedbiobam
  • dedesoah
  • deepines
  • defseca
  • deicommoo
  • deiddqfqf
  • deitires
  • dem
  • dememer
  • dene58er
  • deneserho
  • dennisnas
  • depticoun
  • dernaros
  • deruayno
  • desresu
  • devrandom
  • dew-daw
  • dfathudin
  • dfg9h48f
  • dfilestc
  • dfilet6e
  • dfilew64
  • dfilewne
  • dfsaqd
  • dhbwfwvcwu
  • dhxxczwaix
  • diabmb2
  • diabmbq
  • diamente
  • diasimpna
  • diawritel
  • dibonhen
  • dickey
  • difiklqh
  • dijifsof
  • dijkeartt
  • dikaner
  • dimeda
  • dimitro27
  • dinboco
  • direjor
  • discava
  • discpoma
  • dispano
  • disthilpo
  • distmapea
  • dix6
  • dizh3t
  • dizzyx
  • dkapt
  • dlibch2
  • dlibdkp
  • dlibf1r
  • dlibf9x
  • dlibi94
  • dlibjr7
  • dliblfb
  • dliblzg
  • dlibnsr
  • dlibnt8
  • dll
  • dmbasa
  • dnsods
  • docommoe
  • doiknocep
  • doisova
  • doping
  • dostko
  • dotucmi
  • dowctagar
  • downvidsfbfb63
  • draft
  • dranadem
  • drst0rm95
  • drvvpfug
  • dubi
  • dukmzh
  • dunthesu
  • duqaoqtif
  • duyun
  • dwqnog
  • dxkxaopzja
  • eabtraxyj
  • eadekvoz
  • eajfikoad
  • eascolboo
  • eaurofat
  • eaziljeh
  • eblade
  • ebooks36r
  • ebooks3eh
  • ebooks5vl
  • ebooks9bo
  • ebooksctf
  • ebookscvd
  • ebookscwh
  • ebookseo8
  • ebooksw
  • ebookusexon
  • eccentric
  • ecextech
  • eclipt
  • ecmure
  • edjvu1
  • eefikbaq
  • eerrfd
  • efcqlgq
  • efpcabwuiw
  • efuvgvqbdi
  • ehremati
  • ejgjui
  • ekan90in
  • ekyli
  • elbow
  • elcoce
  • elecup
  • eliverydemand
  • ellonharz
  • emburpo
  • enagpa
  • enannew
  • enanul
  • enapva
  • encyzong
  • endhost2
  • eniubk
  • enkenta
  • enlotco
  • enonhe
  • enonsum
  • enpocchoo
  • enrcolhome
  • entegral
  • entuhass
  • eo77dbj0amkk4li7elchez3m.thehub
  • eovorf
  • epio1uit
  • epubty43
  • eracab
  • erafon
  • eralpane
  • erill
  • eromer
  • erovas
  • esabon
  • esdesmond
  • esfame
  • esilbi
  • esmentho
  • esuler
  • etheriel73
  • etin
  • etterhome
  • ettriben
  • eulogy
  • eumihukmt
  • eurevjum
  • euyaypim
  • evbore
  • evenspok
  • event-codashop4
  • eventcodashop2021
  • evotex
  • evpaga
  • exinex
  • eypz
  • ezura
  • f0rm4x
  • fabbnape
  • fabrmari
  • facebook114
  • facepunch
  • fachada
  • faimonnoy
  • fastdade
  • faucati
  • faykoste
  • fbdviw
  • fblausnir
  • fbook6889
  • fbwatchxxx30
  • fdhayzwq
  • fdvgrqg
  • fecgje
  • fechicoo
  • fecongwar
  • federzvz
  • feedbuv64
  • feedbuvnx
  • feedbuwqh
  • feedbuzul
  • feedbv0h4
  • feedbv1oa
  • feedbv3mg
  • feedbv4lp
  • feedbv54p
  • feedbv69q
  • feedgj
  • feegk
  • fef2gfrg
  • femdaily
  • femine
  • fenopmi
  • ferdinanddubuy
  • fersbuyae
  • fewesnop
  • fewlisavw
  • fezfzf3f
  • ffeventgameclub
  • ffilmsxvi
  • ffilmsxvz
  • ffilmsxyw
  • ffilmszrn
  • ffilmt3yk
  • ffilmt5xa
  • ffilmt87b
  • ffilmt8g0
  • ffilmt9x8
  • fgpi4
  • fiblesup
  • fibsiha
  • ficzu
  • fifapiil
  • filmdotavqtc
  • filritet
  • findit
  • fisebul
  • fitzteva
  • fl-home
  • flereous
  • flycalex
  • fmkavtma
  • fnykydd
  • fohmrznfwy
  • fojexoej
  • foquftas
  • forcores
  • fortunatehoster
  • foryou03
  • foygame
  • freddy
  • frngsrvhha
  • fromageblanc
  • fromwamu
  • fruhf18q
  • fruhf6ql
  • frzvjl
  • fsasdbh
  • fucokxov
  • fulphori
  • furtus
  • fuwaoqvo
  • fuwuucwu
  • fvfoxnbu
  • fwd9k0w3
  • fwsrbyca
  • g4nh1
  • g4rd13n
  • g8zmg
  • gaelit07
  • gagtxw
  • gahardza
  • gaibodar
  • galligni
  • gamedpvm
  • gammiw
  • gaoilfxysw
  • garena-event.free-firexxdd
  • garena-ff1
  • garenafreefire15.gratis-event18
  • gazaran
  • gejafqap
  • genramus
  • geoteli
  • gep
  • gestar
  • getfll5k
  • getflln8
  • getfllnu
  • getflmj6
  • getfln5f
  • getflo9b
  • getflstu
  • getflt0g
  • getflv9c
  • gfufpe
  • gfvdsco1
  • gfvdsevg
  • gfvdsfx3
  • gfvdsfzp
  • gfvdshg2
  • gfvdsj7d
  • gfvdsjcr
  • gfvdsjyj
  • gfvdsoze
  • gfvdspjb
  • ghdcal
  • ghgftgh
  • ghjk62jk
  • gickre
  • giesysdi
  • giomudpost
  • giphyter
  • girefac
  • gito1
  • gizoobgu
  • glimegab
  • gljsfvxt
  • gluccw
  • gnest
  • gobbkongjoo
  • gotland
  • gqdrdlmuxj
  • gqer237
  • graniwyn
  • gravapma
  • greggmomremote
  • grfcob
  • grovl0
  • grvzodww
  • guemasdo
  • guxyvmiz
  • guymanba
  • gyebimi
  • gylipawn
  • h0m3na5
  • h4
  • ha-nizza
  • hackbook
  • hackstr
  • haeconme
  • haepic
  • halleberlo
  • hallmd2010
  • hamis
  • harawe
  • hareta
  • harrulor
  • harrzh
  • hass.carlsonfamily
  • hayaletler
  • hb-quickbooks2
  • hcistt
  • hdtjlotv
  • healopo
  • helenajb
  • herhore
  • hetamagg
  • hevcos
  • hicgera
  • hinuzdaz
  • hiwhea
  • hjkipsg
  • hjkivkp
  • hjkiy9z
  • hjkj1ez
  • hjkj3vr
  • hjkj4dt
  • hjsdhjdsjhds
  • hkpob75
  • hlaqnb
  • hldygw1h
  • hljxqc
  • hm17mysuriba
  • hn4
  • home-55
  • home4214
  • homenat
  • homevlc
  • hoojf
  • housedom
  • houtwal
  • hubot
  • hunewo
  • hwweo
  • hyhkkj
  • hytzqf
  • hywqyiuo
  • i-disappear
  • iatento
  • ibcingu
  • ibenel
  • ibexis
  • icinneu
  • icmbolen
  • icnectoo
  • icuchie
  • icwjspcy
  • iderjam
  • idontknow
  • iefunwan
  • ig-login
  • ihtvny
  • ihwkwi
  • iipejziv
  • ilakhar
  • imbiwhym
  • imirwor
  • imrytpi
  • imsphome
  • inadarlo
  • inamwon
  • inaplit
  • inccomde
  • incoweb
  • inegca
  • inelpros
  • info1219
  • info36
  • info4412
  • infoo933
  • inlapci
  • inlasis
  • inpato
  • inpreqre
  • inraiza
  • insigniachat
  • inurli
  • iohufjeq
  • iothomas
  • iovecyud
  • ipcpovt
  • iqjkgpau
  • ir6
  • irkstorj
  • isamit
  • isidcal
  • ismail42
  • isoc69cu
  • isra
  • istoqrpksw
  • italian84
  • itsupen
  • iufapnow
  • iujasgig
  • iuyafeaj
  • iylwhghwmp
  • izvuyf
  • j42
  • jalilon
  • japan-you-tubes-pthswj
  • jay-b
  • jbcvha
  • jcvnhv
  • jdevega
  • jeffokr
  • jeremy923
  • jetest10
  • jetmaste
  • jeypuq
  • jfhcujej
  • jgarcia
  • jhrrtg5
  • jinnme
  • jisino
  • jizoye
  • jlt2szxi
  • joe540
  • joffor
  • johnston
  • joibini
  • joibumi
  • join-grupwhtsapp-bokep
  • joinmygrub715
  • joker
  • jonathanps
  • josephhh
  • joshuas
  • josing
  • jowbhp
  • jowuhhe
  • jpuqop
  • jqnfqw
  • jstck
  • judith
  • jullinhavideo2
  • jumejkiv
  • juncditu
  • jupyter.pulpo
  • jusluso
  • jutiumfe
  • jzheng
  • jzkuwjah
  • k0rea82
  • k9ef3
  • kada
  • kajsfk
  • kajucuap
  • kancawa
  • karhose
  • katkad.arcter
  • katlinjasperpdf
  • kayatje
  • keana
  • kejyln
  • kenacon
  • keotarre
  • keylisno
  • kfqhtb
  • kfswse
  • kichlela
  • kid6
  • kidsafe
  • killav1s
  • killaxdp
  • killaxn8
  • killayz3
  • killaz2b
  • killb10b
  • killb2tv
  • killb51y
  • kilp0
  • kinggo
  • kingjomzac
  • kinveachy
  • kirasan
  • kitesmak
  • kitocmi
  • kiurusgl
  • kkhili
  • kkhomeassistant69420
  • kkihfz1r
  • kkihg01y
  • kkihg0l0
  • kkihg2ac
  • kkihg2oq
  • kkihg36b
  • kkihg3n3
  • kkihg3t8
  • kkihg56c
  • kkihg6ck
  • kkihg7t0
  • kkihg8i3
  • kkihgakb
  • kkihgapn
  • kkihgbh0
  • kkihgbvd
  • kkihge18
  • kkihge19
  • kkihge2l
  • klhj-hassio
  • klsrib
  • kmjs
  • kodes
  • kojyfvau
  • kommine
  • koopa
  • koprefd
  • koqurgip
  • koredsea
  • kovana
  • kp-73680
  • kromol
  • krwwcq
  • ksvc
  • ku90
  • kubargiz
  • kudthocy
  • kuzucuq
  • kwnlmg
  • kwnr37mc
  • kzagba
  • kziarko
  • l9jc8
  • lab42
  • lacubu
  • ladelap
  • ladsr
  • lalaibci
  • lammergg
  • lanroge
  • larasi
  • lare19to
  • larecka
  • laswzho
  • laswzmf
  • lasx2i5
  • lasx4mv
  • lasx8ph
  • lasxdkv
  • lasxeh2
  • lausouvo
  • lbgdqr
  • lechoni
  • lecornre
  • lectfrigem
  • leeypzq
  • leicarre
  • leitanca
  • lenini
  • leonard125
  • lesfeq
  • lethalbac0n
  • letzblockmilk
  • levazud
  • leyconce
  • lfottm
  • licila
  • lifiecgi
  • lighraca
  • lightiti
  • lima
  • limimit
  • lindapsx
  • lingraho
  • link04
  • liobetdu
  • lionssh-kiiddboil
  • liqvmagx
  • lir
  • lirama
  • lisahe15
  • listronou
  • lisupdi
  • litasnua
  • litetho
  • littleduck0326
  • ljlhjg
  • ljusaqem
  • lkxtss
  • llabukas
  • llnnfi
  • llosqg3
  • llosqwc
  • llosrxk
  • llosw53
  • llot4p9
  • llwlogkn
  • lmgifa
  • lmrffk
  • lndsunfwde
  • lnine
  • lofimo
  • loikdyrefs
  • lolly66
  • longlema
  • lophosur
  • lopikn
  • lopstrk5
  • loramanu
  • losholoa
  • lozacti
  • lpykownqjx
  • lucky96
  • luckyspin-gratiss
  • luckyspineventt2021
  • ludovic
  • luhdunn
  • lujnvv
  • lukasnextcloud
  • lungkjis
  • luttsaje
  • luwlkk
  • lvarpecdhe
  • lvsz
  • m-k8s
  • m0th0
  • m4el1
  • maapuh003
  • mabnigo
  • macoimro
  • macordo
  • macweriu
  • madebcah
  • magonew
  • maidisri
  • mail.0nline3
  • mail.104830
  • mail.109kuotagratis
  • mail.194kuotagratis
  • mail.2.new-garen92
  • mail.292wagrup
  • mail.accountverif-nowedu
  • mail.ambil-hadiahmu999
  • mail.ambilbundlecobra-freefire
  • mail.amz-updatedetails185
  • mail.amz-updatedetails200
  • mail.bjuiesx-pkosesxerqterwcv
  • mail.bokepnew19.chat-watante
  • mail.boyaahday
  • mail.cdfshkjefrf
  • mail.chatwhatsappgroups36
  • mail.claim-item-gg4142
  • mail.claim-mlbbjs8
  • mail.claimbundle76
  • mail.claimitem-oldgg2021
  • mail.claimitemffnewze
  • mail.coda-shoptopup77
  • mail.codashop10.freelom1
  • mail.codatshopfreexd
  • mail.coinbase-notif
  • mail.diamond-freefire-bug-2121-terbaru
  • mail.event-crate-2021
  • mail.event-spin-bundle-new-com
  • mail.eventdm-gratiscodashp
  • mail.eventfree-spincobra875
  • mail.eventterbarufreefireid
  • mail.ff7-evnts-new
  • mail.ffspin2021
  • mail.freefire-allskinvip
  • mail.freefire-misterishop2021
  • mail.garena-freefireegiveaway-2021
  • mail.grub-mamah-muda-2021
  • mail.grub-whatshapp-com
  • mail.grubwabokep
  • mail.grupchatbaruviral
  • mail.grupxxtk27
  • mail.hadiah.eventfreefire05
  • mail.join.grupwhatsap
  • mail.joinchatwhatsapp
  • mail.joinnwa18xxx
  • mail.klaimnewwevent7
  • mail.malingpro
  • mail.mygrub71
  • mail.playmobilelegends14
  • mail.pubgfreeevents
  • mail.rafixdmedia
  • mail.required-verifyacccountamz2021
  • mail.secret-fix
  • mail.spesialramadhan-itemgratis
  • mail.spin-item-freefire-2021
  • mail.spin.gratis.freefire24.freegood
  • mail.spinfreefire-vvip07
  • mail.spinmlbb2021gogo
  • mail.tolls-babyboys
  • mail.tournamentfreefire
  • mail.tripikeytest
  • mail.videodewasaxg
  • mail.whatsapp603
  • mail.yournewlifee
  • mail4
  • maison-moulin
  • maivubi
  • manq13
  • mantaude
  • maparlo
  • marcbrunet
  • marejk
  • markmay
  • maryelt
  • masekotcp2
  • mateddc
  • materdei
  • materialinformatico
  • matheusflach
  • matofigh
  • maxutbic
  • maylekor
  • mcecloud
  • mcfun
  • mcydknkt
  • mdsksu2
  • mdskszl
  • meatbag
  • medenrou
  • meetcid
  • meetkrd
  • meetrla
  • mefihe
  • megaman
  • meiffo
  • melgarflix
  • melvetin
  • merradi
  • mewrgg
  • mgeczq
  • mghsb
  • micvile
  • midtana
  • milufeoz
  • min-min
  • minato
  • mingdesi
  • mingodic
  • mirapo
  • mknqydpj
  • mkvsbhhn
  • mlf
  • mmnas
  • molskazka
  • monak
  • monouvya
  • morsadic
  • motuvuin
  • moz
  • mp89
  • mrtjbz
  • msb9
  • mshop
  • msytsma
  • mta-sts.camcsb
  • mta-sts.commitnz
  • mta-sts.frukta
  • mta-sts.hrwhome
  • mta-sts.ladyhaya
  • mta-sts.luradarr
  • mta-sts.mta-sts.mail.hzserver
  • mta-sts.mta-sts.mta-sts.fowl
  • mta-sts.mta-sts.mta-sts.km-hass
  • mta-sts.mta-sts.mta-sts.mta-sts.machalek
  • mta-sts.mta-sts.mta-sts.mta-sts.zuhome
  • mta-sts.mta-sts.mta-sts.phiphipi
  • mta-sts.mta-sts.mta-sts.pixlit
  • mta-sts.mta-sts.mta-sts.ravina
  • mta-sts.mta-sts.terminal.kirbys
  • mta-sts.mta-sts.video.snwball
  • mta-sts.pasoha
  • mta-sts.twoohtwo
  • mtnsa
  • muidker
  • mumtohap
  • muppet
  • murdinet
  • mustaho
  • mutaper
  • muukuro
  • my904l
  • mydaughterpc
  • mydocnet
  • myebamso
  • myne73ri
  • mzug362
  • n0pf0k
  • nabnano
  • nagoezko
  • namarsi
  • nanathi
  • narimho
  • narvitec
  • nasmg
  • natolco
  • naurefdo
  • nber
  • ncprzs
  • ndesapif
  • nedsa
  • neefoobi
  • neith
  • nempefo
  • nenloate
  • nepeno
  • neringa
  • netflixx
  • new-new-new-new-new-new-new-new-new-www.qwaxdh0h
  • nextcloud-tl
  • ngmtdc
  • nguentott
  • ngwazi
  • nijnenco
  • niligde
  • nimble
  • nipadqiq
  • nist
  • nistino
  • nithila
  • nitrogendioxide
  • niwuhbo
  • nkljhuvmhf
  • nl-1
  • nmoil
  • nn4
  • nob
  • nocoto
  • nokuuspi
  • nonriali
  • noporse
  • noripo
  • normoxic
  • norrapo
  • norrelin
  • nowria63fruch
  • npjlfc
  • npm.cac71
  • nrmz
  • nropresx
  • nsmyy
  • nszmdj
  • nterinal
  • numbuqa
  • nuwizopcig
  • nvhlpn
  • nyd
  • nykjxh
  • nywmtl
  • nzrm
  • oafaxddb
  • oasjjsj.join-grup18xxx
  • oayocmuw
  • obilun
  • oboxas
  • obviede
  • ocinrule
  • ocylem
  • odemog
  • ofswbotg
  • ofxlqenmto
  • oglnuo
  • ogttkrrvmd
  • ogvsxv
  • ohmjpw
  • oigizwos
  • ojcarag
  • okcvwv
  • oktixi
  • olecfi
  • olfbred
  • olimpo
  • omgbot
  • onacgyvi
  • onartoh
  • onbalto
  • onsaked
  • onsy
  • onti93ge
  • onu
  • oprechi
  • optim
  • opus4
  • opyvcom
  • oqsiwe
  • osevgar
  • otchered
  • othvater
  • otlyre
  • ouiwyey
  • ovanes
  • ovopjah
  • ovwitdo
  • owmeaco
  • owunwu
  • oxowim
  • p4vu6u
  • pachili
  • padesdi
  • pamotib
  • pancimil
  • parrimil
  • patenan
  • paulq9m1
  • paytafer
  • pbdyzz
  • pbnii
  • pceqscc
  • pdthuis
  • pedendes
  • pelitepribadeh
  • penedos
  • pennima
  • pentgeme
  • peoplesmart
  • pequepc
  • perniora
  • perockry
  • peropbay
  • perpapo
  • perroava
  • pgbfih
  • pgebarbarano
  • pgitvq
  • pihub
  • pilecri
  • pimeno
  • pingmaca
  • pins
  • pintail
  • piohyte
  • piperovi
  • pixhk35
  • pjikgr
  • pjrriuid
  • playland
  • poccamions
  • pocogto
  • podino
  • podolbe
  • poelanla
  • pollroba
  • poltieho
  • ponm3w
  • ponyvsmonster
  • poqionpo
  • portablg1z
  • pote69ma
  • poxeta
  • precalem
  • prepacce
  • pricvadu
  • prisoxal
  • prodterti
  • proflyfi
  • propreti
  • prqcen
  • pubgbugb
  • punkcuto
  • purdecon
  • pusakb
  • pwvfdx
  • pyasek
  • pzpbvcsl
  • q0ol6
  • q8c
  • q8rp5
  • qamaommo
  • qaquzjer
  • qbgsbe
  • qdwjcg
  • qhgkatzm
  • qioply
  • qjbc1wr7
  • qjjfmo
  • quenehon
  • qufimgaw
  • quilecpo
  • qukdjs
  • quozere
  • qwaxdjml
  • qwaxdm7h
  • qwaxdmhx
  • qwaxdmya
  • qwaxdq3z
  • qwaxdrz6
  • qwaxds3q
  • qwbaaf
  • qwbp
  • r6zj0
  • ractheto
  • raicepne
  • railuti
  • raimami
  • rajacoac
  • rakeibdeg
  • ratao321
  • ratos
  • ratreana
  • razaefni
  • rburoe
  • rchavaf
  • rdfinar
  • rdserver
  • rdskyr
  • readbvdl
  • readfozc
  • readsjlc
  • readxjxm
  • real1
  • reciclavix
  • recsiris
  • redfinance2021
  • rediks
  • reevire
  • refete
  • regan
  • registra
  • rehdare
  • rekrico
  • relexyq
  • relodtoy
  • renkei
  • reokobi
  • resa88ha
  • resnopi
  • reverme
  • rh8
  • rhcjkc
  • rhytojvckm
  • rianoha
  • riarova
  • ridgkcay
  • rilunti
  • riomewa
  • rioumusa
  • riplene
  • riscte
  • rivaadqu
  • rjlpbr
  • rkfbdp
  • rockstar
  • rodney007
  • rogmifal
  • roherrci
  • rokilde
  • rongxin
  • rooftop
  • rorera
  • rota
  • rousseau
  • rqgmcb
  • rrhfsb
  • rszcqm
  • rtmlqs
  • rtyadupa
  • rubenvg95
  • rud
  • ruilota
  • rukvig
  • runs6n
  • rupbefu
  • rustling
  • ruthrk91
  • ruthtj51
  • ruvunzun
  • rvernier
  • rvuoqr
  • rvyqbuaj
  • rxfhfr
  • ryanstore74
  • rytmo-willian
  • s7ea6y
  • sa3w6as
  • safemoredocs
  • saiwield
  • salrona
  • samafec
  • sanpadan
  • santato
  • saqiazra
  • sardd4f
  • sarloli
  • sasapop
  • saturno
  • sauponto
  • sawqe767
  • sbarenas
  • scgrqs
  • schmitt
  • scvlxbpr
  • sdg
  • sec-blok
  • securce35c-office365-live-xn-cae-oed5j
  • semendti
  • senpata
  • sentrera
  • seputi
  • serarit
  • sg1-vpn
  • sgyzfe
  • shaarli.nassantiago
  • shack1
  • shazzy
  • shelbycraig
  • shinusterben
  • shipyondltd
  • shussain
  • sicoidba
  • sidonaly
  • sigjuefe
  • sihevaos
  • silas
  • simeon
  • singular
  • sirflico
  • sirfwq
  • sisafti
  • sivasrui
  • siviexci
  • sixth
  • siyesbif
  • ska
  • skfcqmry
  • skgg
  • skyrocannon3
  • slimai
  • smallxkiddo11
  • smartbuilding
  • smartcomha
  • smatomen
  • smokefla
  • snakeos
  • snibel
  • soahala
  • sobyo
  • sofmikal
  • softball
  • soguarde
  • soirenru
  • sonarr.awsresheff
  • sonleta
  • soparec
  • sopeaza
  • sotj7x
  • spcgmv
  • speczarh
  • speichercloud
  • spinff.infogame
  • sponmyha
  • spresso
  • spserver
  • sqkdraj
  • sqlfdn
  • sqmfzv
  • srecexes
  • sryr
  • ss10
  • ssxrxf
  • stamford-omron
  • starwarsof
  • stearnsarino
  • stepkellaw
  • sterinun
  • sticahvi
  • storaroc
  • storerem
  • strasdao
  • strasebc
  • strasffo
  • strasfpz
  • strasg12
  • strasglo
  • strasgnv
  • strasits
  • strasjba
  • strasjoa
  • strasmpn
  • strasmvj
  • strasn6z
  • strasnoe
  • strasobn
  • strasrpf
  • streef
  • strvqh
  • stupusic
  • subslaza
  • succes
  • suckdwelew
  • sudira
  • suhkalke
  • suidesa
  • suited
  • sunlight
  • sunviet
  • surlug
  • surmaco
  • sus
  • susanpct
  • svc1
  • sverinin
  • swinimet
  • swmyvl
  • swwqavnauy
  • syno.mevy2
  • szebaren
  • szgp
  • szougpz
  • szpufu
  • t8pm2
  • tadesi
  • tafebzac
  • tagenpa
  • tainuma
  • tairemon
  • taitinre
  • takefree-diamonds
  • tal-kampanjol-homeassistant
  • talkva
  • tallf5y
  • tamich
  • tapsofa
  • tapuprad
  • tautage
  • tconenan
  • tdhsfz
  • teacaca
  • techarta
  • tendimis
  • tenmura
  • tenttita
  • terdesi
  • terminus-corinth
  • test.zoersel
  • tetouaan
  • teutelta
  • tfybxa
  • tgoq766
  • tgqpts
  • thaisedy
  • theotherpilkingtonfamily
  • thislanismylan
  • thyone
  • tibqjk
  • tibrpd
  • ticora
  • tifeohba
  • timesi
  • timisus
  • tinorma
  • tiowesmo
  • tipagol
  • tirioguacamole
  • tiruqq
  • titewe
  • titire
  • tjdft
  • tmoviey1v
  • tmxqr02
  • tojzlsy
  • tothanti
  • toyrathe
  • tqzpcv
  • tranimag
  • travel55
  • tremabin
  • tresesca
  • trggklw
  • tripletanfine
  • trm-game
  • trocesre
  • troke
  • trucelho
  • trucerox
  • truffi
  • trusanov
  • tsujintrepabfu
  • ttvzso
  • ttyrdfrx
  • ttyrdh1c
  • ttyrdjzp
  • ttyrdl8n
  • ttyrdmjo
  • ttyrdmp6
  • ttyrdmwj
  • ttyrdmyu
  • ttyrdnce
  • ttyrdp62
  • ttyrdpi8
  • ttyrdqby
  • ttyrdqyf
  • ttyrdrju
  • ttyrdrn8
  • ttyrdsfy
  • ttyrdszl
  • ttyrdtge
  • ttyrdts5
  • tuahdr
  • tufan
  • tuheutpu
  • tujaozvo
  • turacca
  • tvserver
  • tvytqz
  • twn
  • txtos
  • tycomda
  • tynajor
  • tyres
  • tzalkghtir
  • u4sr2u
  • u5yz2p
  • u7wd2
  • ua35
  • uanekfirio
  • uayymzn
  • udbwjarxey
  • uezekg
  • ufyrqj
  • ugnzts
  • ugsmardy
  • ugtprnoz
  • uidcuwin
  • uihargok
  • uitcwp
  • ukayukay
  • ulosun
  • ulroke
  • ulxohdsp
  • umbois
  • umind
  • umutbabapro457
  • unamplan
  • univeg
  • unnadeb
  • unolaler
  • unstedil
  • unt
  • upalcran
  • uratfer
  • urcuprai
  • urdmre
  • uros
  • usamic
  • usztbb
  • uuia2
  • uurntp
  • uwuye.event-garena-2
  • uyinhq
  • v654df
  • v6il9
  • valniopo
  • vaqaukgu
  • varvidoo
  • vatibe
  • vaveree
  • vavergyk
  • vbbku9
  • vbbkxt
  • vbn
  • vbynup
  • vdoqof
  • vdqmjq
  • vdzupofx
  • vegqeoy
  • vegreboo
  • vegsasi
  • vemoke
  • ven
  • venocu
  • venrece
  • vere48un
  • verified-signin-services
  • vetedo
  • vetoxceb
  • veytarme
  • vgskrglf
  • vhb
  • via-cv
  • video-viral2021
  • vilpama
  • vinayh
  • viodesge
  • vioromsi
  • vip11-codashoptrue
  • viraco
  • visase
  • viteha
  • vive-la-laicite
  • vkekhszq
  • vlyzhb
  • vohoacni
  • voinopan
  • volborip
  • volltari
  • voyce
  • vronny
  • vsacse
  • vsdftt
  • vsnews
  • vsnvwual
  • vsru
  • vucapvi
  • vueadmin
  • vumicway
  • vvalicdu
  • vvalida6
  • vvaliggx
  • vvalihfx
  • vvaliibs
  • vvalij0l
  • vvalim4d
  • vvalim7z
  • vvalimqu
  • vvalinyt
  • vwiueb
  • vwtvrl
  • w3mq0
  • w81
  • wa36xc
  • wageoo
  • waitinro
  • wall3
  • walltisu
  • waslusuf
  • waypalan
  • wctfxd
  • weaktiba
  • webdisk.1lhjp7-0008m3-5j
  • webdisk.203kuotagratis
  • webdisk.234kuotagratis
  • webdisk.agil-ganz-vip
  • webdisk.ak-unpemulihan
  • webdisk.amz-updatedetails318
  • webdisk.amzon-signin-8194m1n9-g184
  • webdisk.apisigninverify-authid
  • webdisk.authdasboard-login
  • webdisk.bananahah
  • webdisk.cekburuan.claimeventff-07
  • webdisk.chatwhatsappnakal4
  • webdisk.cjekrntfdfhg
  • webdisk.claim-item-old-freefire-17
  • webdisk.claim-itemlangkaold
  • webdisk.claimzzgratisterbaru2k21
  • webdisk.codaa-shp-real
  • webdisk.codapaytopupgameff78
  • webdisk.codashop-ff-bgidgg
  • webdisk.codashoppgratiss
  • webdisk.codashops78
  • webdisk.collect-moonton-gratis
  • webdisk.comunity-service
  • webdisk.curl-bangssd
  • webdisk.daryzo-freefire
  • webdisk.evennt7.arifganz
  • webdisk.evenntpubgg
  • webdisk.event-mlgratis.claimevent887
  • webdisk.event-pubg-22
  • webdisk.event.wageubsj
  • webdisk.event81ff.grupmabar-notnotyt
  • webdisk.eventcodafree21
  • webdisk.eventidulfitri
  • webdisk.eventsluckyspinfreefire
  • webdisk.eventspin2022
  • webdisk.evnts-garena10-com
  • webdisk.ff11-evnts-new
  • webdisk.ffgarenaresmi2
  • webdisk.folowanveroro
  • webdisk.foursesobn
  • webdisk.freefire-cobra
  • webdisk.freefire.eventznn
  • webdisk.fullnontongrupwa87
  • webdisk.garena-eventspinffold99
  • webdisk.garena-fypt
  • webdisk.grub-whatsapp-dewasa18-2021
  • webdisk.grupbokepnnew
  • webdisk.grupsswhatsapp99
  • webdisk.grupwafullnonton82
  • webdisk.help-whatsapp
  • webdisk.klaim-item-gratis-freefire-terbaru2021
  • webdisk.klaimm-evnt-ff
  • webdisk.loot-crate-free-fire-com
  • webdisk.luck-spinfreefireoldgg
  • webdisk.luckyspingarenafreefire5
  • webdisk.mailapp-infos-update
  • webdisk.pubgbugl
  • webdisk.redit03-xyz91
  • webdisk.secure002bchase
  • webdisk.secure08b-chasee
  • webdisk.skin-claim74
  • webdisk.update-luckspin001
  • webdisk.videodewasaxo
  • webdisk.videodewasaxxxxq
  • webdisk.www-sexy-grup-com
  • webmail.050-secureddns
  • webmail.223-secured
  • webmail.amazon-signin-871r4b01231-169
  • webmail.amz-derry007
  • webmail.amzn-signin-8712nv6b41sent21-201
  • webmail.amzsupport-ticketdashboard1
  • webmail.baimwong
  • webmail.chatgruppviralwhatsapp
  • webmail.chatvideocallnakal32
  • webmail.chatwhastapgrubviral
  • webmail.chatwhatsapp.notnotgrup
  • webmail.chatwhatsappnakal30
  • webmail.chatwhgrup
  • webmail.chodashopevent3
  • webmail.claim-gbv-ghb22
  • webmail.claimcobra2772
  • webmail.claimevent652
  • webmail.claimfreefire-crate21
  • webmail.claimgratisnew-2021
  • webmail.claimhadiah-free
  • webmail.claimzzzgratis2k21-info
  • webmail.clasaq2
  • webmail.codashop-diamond
  • webmail.codashop-topup35
  • webmail.codashop279
  • webmail.codashop49
  • webmail.codashopfreediamond2
  • webmail.consumer-guarantee
  • webmail.coustumer-preme
  • webmail.diamond-ffborg
  • webmail.domain-baru-2021
  • webmail.easyforus
  • webmail.event-freefire-ramadhan.puasa2021
  • webmail.event-freefirexyz-com
  • webmail.event-luckyspinnfreefire
  • webmail.eventclaimfreefiree-news1
  • webmail.eventff-new
  • webmail.eventgarena-freefireterbaru2021
  • webmail.eventgarena7
  • webmail.eventtmy-ffbgiddd21
  • webmail.evnclaims
  • webmail.ff-eventnew2021
  • webmail.ff-lukyroyle-com
  • webmail.ff0.gratis2021new
  • webmail.freefirexyz-com
  • webmail.gareenabgid-xxyz
  • webmail.garenackrip1
  • webmail.gncrott
  • webmail.grenotoyouree
  • webmail.grop-pemersatu
  • webmail.grub-mamah-muda
  • webmail.grupwa-bokep
  • webmail.grupwhatshap.cfree-harenn
  • webmail.grupxnxx.mahisagamtenk
  • webmail.intelhostpaket
  • webmail.item-freefire-gratis
  • webmail.joinnn.gruphotviralbkpyy
  • webmail.klaim-coda-id
  • webmail.klaimgamingg
  • webmail.koiyuux-xiuiresplokniesxwr
  • webmail.lootcrate-gratisff2021
  • webmail.mlbb-event84
  • webmail.mlbbshop
  • webmail.ngocokbarenggg
  • webmail.notnot.join-grupinvit
  • webmail.primarysub-from56871
  • webmail.quickeddreactivate
  • webmail.repair-costumer
  • webmail.secure4mverify
  • webmail.secured-connect
  • webmail.serving-customers05
  • webmail.sezr
  • webmail.suppfl2msmskfusjapplesjg2dss
  • webmail.vidioviral092
  • webmail.vip-joinwhasap99
  • webmail.whastapgrub
  • webmail.whatsapp691
  • webmail.whatsapp861
  • webmail.xnxx-vrll
  • wekuqxoc
  • wesrzm
  • wfymgd
  • willeoo
  • william-mason
  • wine
  • winning
  • wireguard.atupaitso
  • wirlheiha
  • wizco
  • wjhryj
  • wlrvwo
  • wmvtji
  • wn-home
  • wnpp4
  • wnyfqf
  • wohihaom
  • wolfson
  • woncilaz
  • wordoca
  • wuvijdz
  • ww45
  • www.31.whatsapp-join-1
  • www.coda.newevent-freefire7
  • www.event.spinold6
  • www.eventfirefree.berbagai
  • www.eventtgrtssd.subsitemff
  • www.gheimwolke
  • www.git.lilithlovelace
  • www.h.whatsapp-grubb2
  • www.haad
  • www.klk-yga
  • www.lukyspin5.newevent99
  • www.nginxcadet
  • www.novea
  • www.s.hadiahfree
  • www.serviceaccountid-limitedinf0.belridfjrh
  • www.shmpx
  • www.tracdxb
  • www.xionoix
  • www.zssxu
  • wxcv
  • xaug78
  • xazu34it
  • xbhu78
  • xbzg78
  • xcds
  • xdropys7
  • xdropz6p
  • xdroq035
  • xdroq36b
  • xdroq3dp
  • xdroq3w5
  • xdroq4b9
  • xdroq4gl
  • xdroq60v
  • xdroq7mx
  • xdroqd2x
  • xerd753
  • xerqs123
  • xetogcoo
  • xfileyt
  • xfom9
  • xforce64
  • xggq
  • xige
  • xitexmox
  • xjaj78
  • xkrn78
  • xkunkhsu
  • xobomcmgup
  • xotpfs
  • xoytqn
  • xpej78
  • xu
  • xueconno
  • xukirae
  • xumairla
  • xumautzu
  • xuormw
  • xxvolvg5
  • xxvolvpo
  • xxvom1gs
  • xxvom217
  • xxvom65y
  • xxvom6z0
  • xxvom7gh
  • xxvom91w
  • xzrwis
  • yaj
  • yaquhquh
  • yasofmek
  • ybhass
  • ycnhyc
  • ydcsga
  • ydgvcf
  • ydkrwo
  • ygjivp
  • ygwf
  • yhij660
  • yiqizsuc
  • yiroaxri
  • yjuqanys
  • yoyifi
  • ypvpyaum
  • yqquit
  • yt6
  • ytecle
  • ythg3
  • yudeayka
  • yumqeeyp
  • yumyqy
  • yunizve
  • ywwasv
  • yxaxfz
  • yysegw
  • z9744pqawq9
  • zalupatk
  • zalupaxp
  • zalupdx1
  • zalupdy7
  • zalupghe
  • zaluphq9
  • zaluphsn
  • zaxoulro
  • zbwhcg
  • zdigxhgfpq
  • zdlhra
  • zekevze
  • zfeafe1f
  • zhknfr
  • zim01
  • zip-home
  • ziraoppa
  • zlfrsb
  • zoriiwzo
  • zudedy
  • zuhnff
  • zujiwvis
  • zwpgpy
  • zwtljx
  • zzzbyj
  • 3asas
  • 8577
  • achook
  • alexhassio-415
  • allantisor
  • arviragu
  • barreirapedro
  • batwavedocumentserver
  • beechtree
  • cpcontacts.att-orangedns
  • cqshome
  • darkdemon
  • darkflower
  • event-gratis-garena-freefire9
  • fatalbertbwrs
  • felixlechat35
  • gall002
  • groenewoud1
  • hanto
  • hopetoun
  • jipo
  • lababo
  • lys-jnas
  • macronid
  • mail-casa
  • maisonabs
  • merlijntest3
  • mta-sts.hasscave
  • mta-sts.nappatie
  • mta-sts.skynet-dohjoe
  • mta-sts.sofyrain
  • na7kr
  • nickslab
  • nmaoi
  • nnote
  • noddybots
  • phenixdomo
  • phenoixserver
  • relativity-tools
  • riccardotosi
  • root-n8n
  • s8vhsnextcloud
  • san-juan
  • scorpia
  • scoutcloud76
  • silt
  • sofia-zzzz
  • subhas
  • tapukdagadu
  • topsecret09
  • twabi2
  • txstreamjb
  • uchimemo
  • unicumnext
  • unique-voice-246420
  • webdisk.globalzza
  • webmail.amazonlock
  • webmail.wellsenteraccoun
  • weppa
  • workflo
  • www.atlasombi
  • yhkkg
  • 0a9g4pwf
  • 2025
  • 3jrug7s
  • 6573543
  • 6ab91
  • aifuydix
  • beautycare
  • cpcontacts.amzservicreliefpandemicdeutchegerman
  • dizovaug
  • downloads.netwerk
  • dwi
  • ebook14
  • eldincharity
  • eorprrs
  • hjk31zsre98jh
  • jisebced
  • jvnwwbib
  • lktfuwz
  • mail.megolodon-spin-garena
  • mail.serurepass-acces
  • merdoboss
  • mta-sts.mta-sts.mta-sts.dashony
  • mta-sts.mta-sts.mta-sts.mta-sts.www.arcadian
  • omega-k
  • patterri
  • resiliosync.thewidowlicker
  • rt1888
  • sjva1.oyso
  • test.blassio
  • tuer.romberg
  • tylorornat
  • vriojiry
  • vuhuflic
  • webdisk.kdidikd
  • www.tmic
  • ydufszfxzzhfhcdyduccxxjcvkccucfcjczzxufu
  • zebadiahashlie
  • 9lhmjzetj
  • abelnextcloud
  • apikscollabora
  • barroszm
  • casa-lino
  • cerebrate
  • cos
  • cpanel.pwljd
  • cpcalendars.thegioituoiten206
  • dafo
  • dawpi
  • deepisyourlove
  • dzivoklis
  • forber
  • franzen0328
  • gietnaad
  • hasam33
  • hauserdr
  • huber
  • idapleurifmeb73irye
  • iwiny
  • jjdvha
  • kinobog
  • kznpbqfjlfa
  • ladrach
  • langfordpass
  • leemx
  • limmybitwarden
  • lulu22
  • mail.loginvalidation
  • mdl-hassio
  • miaamh
  • milotic
  • mta-sts.mta-sts.jrgarrett
  • mta-sts.mta-sts.wadaky
  • mta-sts.timelogstudio
  • mta-sts.woodstockmorrison
  • newcomunicador
  • ozproject
  • paidottwebtvapi
  • planigrafo-service
  • plex.battosai
  • potufilnoa
  • pylnijtluhr
  • qnapkvasir
  • sdn-home
  • sevree
  • simserver
  • sn4ke
  • sonarr.plex-009
  • stefflix
  • storminnorman
  • sweeter12
  • sypan
  • thinsg92
  • unraidrenlahulpe
  • utzapro
  • vmu
  • webdisk.idham69
  • webdisk.jiuenfj
  • webdisk.login-microsoft-sharepoint35
  • xemphimhotnhatngaynay1
  • yaronsos
  • zolabus
  • 3101
  • abnornell
  • aleckkeren-hapuch
  • bayujwac
  • coira52lu
  • cpanel.amzn-signin-871mkv251
  • cpanel.freefireevent5637
  • cpanel.hotvideoxxx
  • emmettaerynn
  • fkrrfxua
  • fulky
  • ghvpn
  • hbpnet
  • hihuldun
  • info6506
  • kenazgracie
  • kmit
  • mail.eventkulgargiveaway
  • mail.sendblizhome
  • mitchellailsa
  • nasjuanlu
  • nhx
  • play2753
  • push9
  • redodeok
  • rodebbem
  • routed
  • secure01b-chase-dashboard-authentication
  • sonarr.dangertoes
  • supastoff
  • syncmsfc
  • ventpubgfree
  • webdisk.account-recovery-coinnbase
  • webdisk.freeskinmobilelegends
  • webmail.oiushd
  • 000orca
  • 31nevern
  • adami14
  • aldous
  • anhome
  • anmo
  • archmisha-home
  • bantyworkshop
  • belinned
  • bennyhome
  • bessen
  • bihi01
  • blagdonlodge
  • blegny206
  • blomfeldt
  • bluehomex
  • brettshahome
  • brohrich
  • bubblefra
  • chinisho
  • corignis
  • courteaud
  • cysroost
  • devlobsters-documentserver
  • dinizrexi
  • doph
  • duckupssh03f7m
  • elreysrl
  • finkbot
  • fusion-home
  • globalvpn
  • gn148q
  • half-asleep
  • hasshole715
  • home-andrea
  • hptn27
  • jarvishomebot1800
  • jelly-perseo
  • jziot
  • korna12ul
  • korniienko
  • kovaleff
  • kr-1
  • lindnagy
  • luvhouse
  • lytkjhmtpf
  • makarihome
  • mdx1
  • mediase7en
  • memati
  • milkain
  • mitac
  • mta-sts.cpanel.mototalk
  • mta-sts.mta-sts.foodfamitsu
  • mta-sts.mta-sts.we3
  • mta-sts.mta-sts.ymazlumyan
  • mta-sts.vitberget
  • mta-sts.webmail.exndq0ndqxo
  • nbiss
  • nextcloudtech
  • notnotgeorge
  • nybrottsveien1
  • oiyer
  • overbiscuit
  • palmierish
  • patreas
  • pentola
  • petee
  • petitmaison
  • plep-radarr
  • qldbiz
  • quankim
  • rasppitom
  • rednotice
  • republiccraft
  • rittmestern
  • rooneyhome
  • rormeister-deluge
  • rsn
  • rytfuygiuhgiyfx
  • ryuuvpn
  • sacre
  • saleh4next
  • sexwhatsapp
  • shcong
  • sisbnc
  • sp3
  • streamanonanomous
  • tkljqn
  • valentijn-op-reis
  • villawarrior
  • www.donev
  • xekihcmqr
  • xpjmcasa
  • xtdkqubg
  • 00z2d
  • 2019.bingpowradarr
  • 2019.chaletmick
  • 2019.cicd-javaloom
  • 2019.cloudilpaguro
  • 2019.frodehf-brygging
  • 2019.hass-esther
  • 2019.hassiodraw
  • 2019.jlvdd
  • 2019.klaasdm
  • 2019.lcfaria
  • 2019.lcv
  • 2019.marekhassio
  • 2019.mjdocserv
  • 2019.mysemfam
  • 2019.nashsabode
  • 2019.nguyenducanh
  • 2019.perseosblog
  • 2019.pomstazlesa
  • 2019.prasadunraid
  • 2019.rasphassistant
  • 2019.runehomeassistent
  • 2019.santpau
  • 2019.scandrohassio
  • 2019.sg74hsh
  • 2019.suitelife
  • 2019.t35t4boss
  • 2019.themassrelay
  • 2019.toembed
  • 2019.willmoreserver
  • 2020.alexmaksimov
  • 2020.ancodia
  • 2020.andyhd88
  • 2020.barbdeaon
  • 2020.fabio65
  • 2020.farmae
  • 2020.federicoghinhassio
  • 2020.ffwsl
  • 2020.fikus
  • 2020.filoni
  • 2020.ggbebe8
  • 2020.giamalo48
  • 2020.hbo
  • 2020.individual
  • 2020.ironnewhome
  • 2020.jitsi-lab
  • 2020.joaopedroneves
  • 2020.jspiano
  • 2020.karizmawow
  • 2020.kimsaetran
  • 2020.login-microsoft0nline98765
  • 2020.mbelanger
  • 2020.mta-sts.mta-sts.mta-sts.shadowspire
  • 2020.ncserver
  • 2020.nunesreality
  • 2020.plexhass
  • 2020.remoteha
  • 2020.rgn-ha
  • 2020.robertobinetti70
  • 2020.rtmplivevision
  • 2020.secured3dpayment-bpi-acceslink
  • 2020.tarchomin
  • 2020.ternopilska
  • 2020.timek
  • 2020.tokyobicycle
  • 2020.transtigen
  • 2020.wietek
  • 45404540
  • 4ytjtrc2xf6
  • aaronel2
  • aaronj09
  • acetamid
  • adguard.jmm85
  • adhocit
  • adju
  • admindidi
  • ags
  • alerflores
  • alone
  • alvora5
  • ampfta
  • amz-verification356
  • andrepi4
  • anneas
  • antoinewouters
  • aofkjeohp
  • apeskz
  • apigw
  • appeasably
  • aronmosagata
  • arteriosympathectomy
  • asparsubc
  • assassa33
  • atlassian
  • ausov
  • autodiscover.redirection02-secured
  • avifilmop6s
  • backup.auralexthib
  • baebae
  • baixar-matlab-gratuito
  • baixar-pes-2018-pc
  • bajde
  • bandicot
  • barbaraon3722c
  • batu33tr-web
  • bawan
  • beheader
  • bertingnounnist
  • besameymucho
  • besblmlnac
  • betattered
  • bibliope0f8
  • bimetallistic
  • binnsy
  • biogisma
  • blcblcblc
  • blisscateline
  • blog.brt-ha
  • blog.chechidesktop
  • blog.moodley
  • bnhqqo
  • bodhhoome
  • bonobot
  • brenerber
  • brilupexim
  • brontecla
  • bsoolhdm
  • bsoolmi6
  • bug-diamondterbaru
  • bulle
  • bunnizx
  • c7
  • calculated.plwebtest1
  • cam34134
  • camezaki
  • catseye
  • cctrevxc
  • cctrexyh
  • cctrf7lj
  • cereals
  • cervicolumbar
  • chappie
  • chbnfooqdc
  • chedzaa
  • chirpstack2
  • churocraft
  • ci.video-japan-margaret-hill-wnp
  • citizensbank-usa
  • claim-item23
  • clarksyuma
  • coberup
  • codaaashopff
  • codashop-eventgg
  • codaxhopevntff21.codastaen
  • colect-skinmlfree
  • colingaku25
  • como-baixar-mafia-2
  • coronovac
  • cpanel.1lj2lw-0008fx-as
  • cpanel.ain.aja.eventsahur
  • cpanel.amzon-signin-8194jukst233
  • cpanel.amzon-signin-8712k4m573
  • cpanel.claim-event-ff28d
  • cpanel.codashop.untk.freefiregratis1
  • cpanel.codashopfreediamond-vips
  • cpanel.event-creat-gratis
  • cpanel.event-freefire-2021-new
  • cpanel.event-freefiregratis2021
  • cpanel.event-mobilelegend
  • cpanel.eventgratisresmigarena
  • cpanel.eventnews89
  • cpanel.eventspin56
  • cpanel.eventstfreefire
  • cpanel.ff-eventz2k21
  • cpanel.freeeventclaimss-freefireeklik1
  • cpanel.freefire-indonesia-games
  • cpanel.freefire2118
  • cpanel.garena-freefire345
  • cpanel.icloud-appleids
  • cpanel.lambilakunffgratis
  • cpanel.luckeroyal
  • cpanel.lukyclam83
  • cpanel.masuk-xxhotchat
  • cpanel.secure09c-useronline
  • cpanel.secureusercha5e-weblogin03a
  • cpanel.secureweb003d-userauth
  • cpanel.tools.hendro-hostlive
  • cpanel.topup-gratis.spingarena-57
  • cpanel.vip-spinfreefire-new
  • cpanel.vip-youclaimfree071
  • cpanel.zafarrtu
  • cpcalendars.1lj2lw-0008fx-as
  • cpcalendars.acctlogin-check-routine-validation-step
  • cpcalendars.amazon-signin-871sella1-162
  • cpcalendars.amz-updatedetails408
  • cpcalendars.appr-semogabahasieqsadqqadaweew
  • cpcalendars.bagi2dmff
  • cpcalendars.chatvcsnakal33
  • cpcalendars.claim-crateff5
  • cpcalendars.claim-itemffgg7
  • cpcalendars.claim.claim-itemruok
  • cpcalendars.claimdiamond-gg2021
  • cpcalendars.claimeventinfo
  • cpcalendars.claimitem-freefire-2021
  • cpcalendars.codashoopfree2021
  • cpcalendars.codashop-allgamegratis
  • cpcalendars.codashop782
  • cpcalendars.codasshop-cdsp
  • cpcalendars.confirm-myaccount
  • cpcalendars.download-educationsmart121
  • cpcalendars.even-garena-terbaru
  • cpcalendars.event-lukyspin2021
  • cpcalendars.free.claimold-free
  • cpcalendars.freefireluckyspinhadiahgratis
  • cpcalendars.gabunggrupvcs10
  • cpcalendars.gshsjejsjsj
  • cpcalendars.home03becu-org
  • cpcalendars.limamenut
  • cpcalendars.link.chat-wagroup1
  • cpcalendars.luckyspinffgratis21
  • cpcalendars.meanpoomper
  • cpcalendars.profilevalidation9q-authlegalaccess
  • cpcalendars.redirect34
  • cpcalendars.secure7uverify
  • cpcalendars.spindayevent5
  • cpcalendars.tessc-2mail
  • cpcalendars.topupgratis.subscrebchanelarif
  • cpcontacts.12support001
  • cpcontacts.1li05g-0008wt-fg
  • cpcontacts.1ljllp-0007xy-h8
  • cpcontacts.2-aggiorna-id
  • cpcontacts.acctlogin-check-routine-validation-step
  • cpcontacts.amazon-signin-87mi11-164
  • cpcontacts.amzon-signin-8715kezrz334
  • cpcontacts.chatvcsnakal17
  • cpcontacts.claim-claim-event-terbaru.event-hadiah-garena
  • cpcontacts.claimevent-freefirenews
  • cpcontacts.claimffevents1
  • cpcontacts.codaashopvil
  • cpcontacts.codashopnewvip1
  • cpcontacts.codashopppp12
  • cpcontacts.durex-alliex
  • cpcontacts.event-freefirebgid2
  • cpcontacts.event-skin-new-ff
  • cpcontacts.event22
  • cpcontacts.eventff-terbaru26
  • cpcontacts.eventgratis-evogun2021
  • cpcontacts.ff-spin99-com
  • cpcontacts.free-dmfreefire
  • cpcontacts.grup-mabarytber
  • cpcontacts.grup-whatsapp69plus
  • cpcontacts.hadiahresmigarena
  • cpcontacts.infogarenaclaim
  • cpcontacts.join.tanteegirang
  • cpcontacts.login-coinbase91
  • cpcontacts.luckynewevent
  • cpcontacts.secure-account-information
  • cpcontacts.secure-information
  • cpcontacts.secure002c-userauth
  • cpcontacts.secure003b-userauth
  • cpcontacts.secure60-chase
  • cpcontacts.secure8l
  • cpcontacts.serv-chserst06
  • cpcontacts.spinkeburuntungan3881
  • cpcontacts.support07portal
  • cpdz6gd1q
  • cpnwdtkqsf
  • cravtors12po
  • cremains
  • ctrmoyigjl
  • culpfofi
  • cvcxyypjui
  • danjula
  • datingcmv
  • dchjtzfmnx
  • dcinemay3u
  • dcsha
  • ddesfua
  • ddesn6o
  • ddos-ty
  • deborahgl8235i
  • defensa
  • delgadofileshare
  • deqortaj
  • der5shaun
  • descargar-mudica
  • deukaerulez
  • dfilew6n
  • dfnpuf
  • disneman
  • divided
  • dns-server
  • docomorjfa
  • dolguldur
  • dom-assistant
  • dongel
  • drnavtransmission
  • dustfrenal
  • dvmaster-depa
  • ebookusespt
  • ebookusf0g9
  • ebookusf794
  • ebookusf79j
  • ebookusf7bp
  • ecodeck
  • ecosistema69
  • egalbel
  • eleadul
  • elizabethsworld
  • ellugardemirecreo
  • elnaro
  • emcrom47bran
  • emgrobesnas
  • etuj
  • evennt.createold78
  • evenntff1.createold78
  • event-freefire-ramadhan
  • event-spinold453
  • eventdaribangbudi
  • eventnewgratis
  • eventterbarugameindonesia
  • f8475
  • fampc
  • fbbjgdedzihmrnit.plwebtest1
  • ff-evnt06-com
  • fferivap
  • ffilmsynq
  • ffilmt34h
  • fisidmi
  • fleettowingservices
  • fortnbooktfi
  • freefire-bgid
  • freeskinmlbbneweventct
  • fruheyfe
  • fsdhgghj
  • galingale
  • garena-event-frrefire064
  • garenaeventt245
  • garenafreefireclaim1134
  • geminiflorous
  • genlee
  • getflkqk
  • gewrruyi
  • gfkappa
  • gfvdsfnj
  • gillet
  • giltheads
  • gioulofi
  • goaremes
  • goloh
  • grandmastella
  • grup-bokep-indo2021
  • grups.freefirebgid
  • grupsxx1
  • gseskjwjvj
  • gtavirtualcityy
  • guidepdfkti
  • gukwjgk
  • gxtkpvzgmp
  • gyre
  • gyseper
  • hahay-test
  • hamjpalmeida
  • handbrake.mizzou-tigers
  • handbucua
  • handler
  • hassio89b
  • heimdall.furyapps
  • hemozoon
  • hesacell
  • hgiwilryak
  • hgtg
  • hjortestien61
  • home-media
  • hoopole
  • hott.subvidivd
  • housetranha
  • hp25
  • htfuujvvvi
  • hypobranchiate
  • hytoro
  • i7l
  • icofebspyk
  • icyivfkfly
  • ilyas007
  • imag
  • incorporateddesignfirmwaresdell
  • infrastipular
  • insusceptibility
  • intersected
  • invidia-nas
  • irresistance
  • istpmzirfs
  • ivorypark
  • ivyhunt
  • jackett.akives97
  • jelly.jsoler
  • jgewy61
  • jilnau
  • jkcam
  • joingrub-waneww
  • jointress
  • jonbc
  • jztkuwvypn
  • k9pm7i
  • kaungmyatthu234
  • kazy1232
  • kecotha
  • kellermann
  • kelokun
  • kevancolena
  • khotsojdvcal
  • killasj5
  • killb22u
  • killb6b1
  • kinzman
  • kiodtes43
  • kkihg0aa
  • kkihgc6z
  • klerl4t
  • kostahm
  • kqwgqkyigq
  • kretw
  • krueckehome
  • kypuwkqsva
  • l3-cl6
  • larxduoxvl
  • lasxahm
  • latnife
  • lebteli
  • leephadior
  • legerity
  • libricv1pj
  • libricv2pc
  • lider-matriz
  • liquzeek
  • liropol
  • lisarb5149z
  • lisauw3165s
  • literwei
  • lnd.ruiner
  • locomotives
  • lopped
  • lsnerjszfi
  • lssb-grocy
  • lucky-spinfreefirefree
  • macroeconomics
  • madrona
  • mafurdi
  • mahmutullah
  • mail.amz-updatedetails250
  • mail.bkp7.grouphots3x18
  • mail.bkpviralvideo
  • mail.bokepsangefreevideo
  • mail.clammitemkobraberhadiahggzz1
  • mail.codash-opefreedm
  • mail.codashop-top-up-game-indonesia
  • mail.diamond-free2
  • mail.evennt4.arifganz
  • mail.eventclaimhadiah2
  • mail.eventspinfreefire-gratis11
  • mail.fff.free-spinnotnot
  • mail.gabung.g0ojoin-gruphot
  • mail.garena-eventt877
  • mail.garenafreefiree-eventclaimfreeterbaru1
  • mail.garrnaslihadiahh9
  • mail.grupwa18fullvideo55
  • mail.lucky-spinnew
  • mail.old-garenaff018
  • mail.online-secreverfy04
  • mail.onlinesupport05b
  • mail.playforit
  • mail.redirection90-secured
  • mail.secure-dashboard-amazonsprimepay
  • mail.secure006-safe
  • mannydnd
  • manv
  • margaretfv2670j
  • marygee
  • maymortne
  • medallary
  • medeyusa
  • meqaikqu
  • mghlg
  • mgms
  • mhhomeserver
  • micaiahtiphanie
  • millimho
  • mkjnubycvfse
  • mrbeann
  • mta-sts.mta-sts.mta-sts.guro
  • mta-sts.mta-sts.www.duckcv
  • mta-sts.okoslak
  • multicrystalline
  • musculoelastic
  • muwahigo
  • mwkxlczrer
  • mxova54
  • my984d
  • naishiofpage
  • natanbnu
  • natwestserviz
  • nbouhyxanh
  • ndlovukaziskat
  • nenrianintsu
  • nerfthan70bal
  • neubackto
  • nivius
  • nkaimcaudle
  • nomenclatures
  • nonregistrable
  • noshslfr
  • nuguchiplachapi
  • nxamani
  • odontoglossate
  • ohoney
  • old.woodstockskitz
  • olympicsbegins
  • ombi-thebartez
  • ombi.nickolasw
  • omniparent
  • onlinefilmez8x
  • onlinefilmezzi
  • onlinesecureusr
  • opganva
  • oqakxgfiou
  • ortkxemvcz
  • ospirulinedy
  • outvxegtdu
  • overhonest
  • owenkrueger-homeassistant
  • owfrcueski
  • owingai
  • owm
  • ownercsdark
  • pacahsud
  • pandesalog
  • papers.pcaro
  • paraibacs
  • pdfdemanuasdx
  • pdfdemanuax1g
  • pezarwa
  • pinos
  • piseth
  • pmhome
  • pnmatias
  • poffycloud
  • popqnap
  • portainer.horv
  • portocolom
  • pptxxj
  • precedential
  • presubscriber
  • prices
  • prof-it
  • proleaguede
  • proxyweb02
  • pvdheyden
  • pynyq0ncpl5wk1b4a9grt937kq4ou2xtqxw51waj
  • qbittorrent.uriel6
  • qecusbuj
  • qgttyv
  • ralcaho
  • rarfija
  • reigalpo
  • remotesavageunraid
  • reprokd400
  • reptiliform
  • resplendent
  • reviewwow
  • ricsxn
  • rieliro
  • riyaneida
  • rkawaijp
  • rloch-t1
  • robertalexa
  • rootdie
  • roustabout
  • rss.toweremy
  • rupaguuh
  • rznas
  • sapu
  • sarahzv
  • saucoco
  • savel7
  • scythestone
  • sebuywogr
  • sekiyaniopiki
  • senmi
  • sersiwha
  • serwoca
  • shiimoo
  • shorebird
  • shzemy
  • sj12
  • slavapkcgt
  • sneyky
  • snylnx
  • soareshome-us
  • sonar.masalborna
  • sonar.video-japan-karen-campbell-mnv
  • sonarr.smarty-home
  • spinmlbb2021gogo
  • ssdasdsadsad3
  • ssgp4-auto
  • strahdwashere
  • stramonies
  • strasff1
  • strasj78
  • straso9s
  • strasp89
  • strasra4
  • suppmisce
  • survive
  • svbwac
  • sws
  • tacxreoyty
  • tan527
  • tarrier
  • tdqhkxwgho
  • teknik
  • temptresses
  • theomota
  • thepress
  • thunder123
  • tmovif6f2
  • tnhgd
  • toidice
  • tonno
  • traceability
  • traeway
  • trailz
  • traplover420
  • travel56898
  • tsukiafoenani
  • tsxsgthjdr
  • ttyrdncm
  • ttyrdo5q
  • tureengsdb
  • txsyzuhcnm
  • uavmgpwcag
  • ujoqnyfj
  • umesat
  • unstout
  • uonpsogcbt
  • uqiktgnwzb
  • ustwoo
  • utzfsfscfv
  • uumvfwuwzf
  • uxscpvxdgq
  • v-c-andrews
  • vefa
  • victorfish
  • video-japan-maria-hall-kcf
  • video-japan-sandra-turner-dgv
  • vipunipingame
  • viralgrub19
  • virally-jitsi
  • virtbooseu
  • virtboouwn
  • visual2
  • vorteey
  • vvalicgb
  • vvdn8
  • wakins
  • webdisk.1lhgzh-0003vn-cd
  • webdisk.1lj7if-0004jb-eh
  • webdisk.amzon-signin-8194mks-177
  • webdisk.burnxs-coinbaseteamsupport
  • webdisk.claimitem-freefire-gratis-2021
  • webdisk.codafree-2021
  • webdisk.codashopid-free
  • webdisk.codashopramadhan991
  • webdisk.evenntff.createold78
  • webdisk.event-freefire2
  • webdisk.event-gratisan-ffgg
  • webdisk.event-lebaran-1
  • webdisk.event-misteryklaim
  • webdisk.event.eventclaimfree
  • webdisk.eventclaimsgarenafreefire999
  • webdisk.freefrw-ecen
  • webdisk.freespin-freefireenews
  • webdisk.galerosiry
  • webdisk.garena-free-fire2021
  • webdisk.gratis.eventterbarugameindonesia
  • webdisk.gropobbtt
  • webdisk.grubbkp.xyzcomdogrub
  • webdisk.grupbokep-6955
  • webdisk.item.claim-eventffgratis1
  • webdisk.mengfani
  • webdisk.mlbb-event92
  • webdisk.new-crateitemff
  • webdisk.newclamitemffggzz2
  • webdisk.pageservice-coinbaseeacc
  • webdisk.redirectiotrun75-secured
  • webdisk.secure-webl0gin015
  • webdisk.service-account-paypalslimited-portal
  • webdisk.serviceres-etmt
  • webdisk.signon-verify453
  • webdisk.spesialitem-gratis2021
  • webdisk.upshort
  • webdisk.user-paypal
  • webmail.18grupwafullvideo70
  • webmail.1ljsfm-00079g-nt
  • webmail.1ws6r4hg6ew
  • webmail.amazon-signin-871s4n1n1231-160
  • webmail.captcha-redirector
  • webmail.chatvcsnakal19
  • webmail.chickavailabilitywq
  • webmail.citizens-restore
  • webmail.claiim.itemold-freefire
  • webmail.claim-event-ff-neww
  • webmail.claim-itemffgg99
  • webmail.codashop.event.diamondff.ggdm-2021
  • webmail.codashop.eventcodashop-xyz
  • webmail.crate-claimff5
  • webmail.eventgarena-news3
  • webmail.eventgf-claimzus
  • webmail.eventkerenff
  • webmail.evntt21freefire
  • webmail.evnttmlbbnew1
  • webmail.faceebook33
  • webmail.faceebook48
  • webmail.feccebookkonfirmasiid
  • webmail.ff-event85-com
  • webmail.ff.free-skinlangka
  • webmail.ffnew-292009
  • webmail.freefire-codashopid
  • webmail.freefireeeventt-claimsnews
  • webmail.gratiseventdarigarena
  • webmail.groupbokepsjepany
  • webmail.grubwhatsaaphott
  • webmail.grupbokep.claim-eventfree-2021
  • webmail.keirojen5
  • webmail.luuckyyspiin0993
  • webmail.new.cobra-event
  • webmail.redeem.itemold-gratis
  • webmail.secure5bverify
  • webmail.secured07verify
  • webmail.servely-verifyyouraccount122
  • webmail.spin-ffcobragg8
  • webmail.spingratisdarigarena2021
  • webmail.updatechasmyaccountservice30b.duckdns.org
  • webmail.userservice-pp-reset
  • webmail.viralbkpjoingrup
  • weqt3t
  • wevawea
  • whm.spin-itemfreefire
  • whoami.dimmek
  • wolfvx
  • wordpress.brnfamcams
  • wordpress.casasmart1
  • wordpress.cjcloud
  • wordpress.cpcalendars.indosex.betlay
  • wordpress.focusthedog
  • wordpress.fredbacon
  • wordpress.greenhouse-11
  • wordpress.harrishome
  • wordpress.hoggarthsynclounge
  • wordpress.ivh
  • wordpress.jclny3kl6nega5tyjersrfsp
  • wordpress.jeremyhouse
  • wordpress.joshua-home
  • wordpress.kastje
  • wordpress.lacucaracha
  • wordpress.mungicloud
  • wordpress.nick-flix
  • wordpress.poiuhnlkmm
  • wordpress.ppefashion
  • wordpress.riopan
  • wordpress.somdahl
  • wordpress.sootertechaudiobooks
  • wordpress.srvmvchat01
  • wordpress.thedurbanking
  • wordpress.torgny
  • wordpress.uhdbits
  • wordpress.valencia-home
  • wordpress.vedskjulet
  • wordpress.wssp14
  • worlraro
  • wosubienduaha
  • wp.andy2801hassio
  • wp.avoidthis
  • wp.bubbayerbs
  • wp.carta8
  • wp.casareggioemilia
  • wp.dempsha
  • wp.enander
  • wp.fleehassio
  • wp.genik
  • wp.hhgb
  • wp.home-assist-5000
  • wp.imperialoctopus
  • wp.lsodh
  • wp.malteklug
  • wp.mta-sts.cpanel.panskamoda
  • wp.mta-sts.mta-sts.localhost
  • wp.myhassq
  • wp.myparadis
  • wp.nandi-test
  • wp.ppefashion
  • wp.private-strumbo
  • wp.remotehassiocjm
  • wp.salvo0825
  • wp.services82
  • wp.umpitunneli
  • wp.yongui
  • wpt68
  • wrqhyxoqar
  • www.claim-claim.gratissan
  • www.copyright.security-account
  • www.csy
  • www.event.claim-eventffgratis1
  • www.freefire1.hefonur
  • xdroqb1o
  • xxvolxx1
  • xxvom4ts
  • ybsmyo
  • ynczkk59g0z-57pp.vk4tux
  • yobaraavunmo
  • you-video-japan-dyzzfy
  • ywnnaazyyl
  • zalupf67
  • zbakuzjpvb
  • zenica
  • zyihcau
  • actinidia
  • alices-house
  • anxlqkijtt
  • araujos
  • atopesound
  • b-rad-pad
  • balbinator
  • bugge
  • carnei-ro
  • devdrive
  • fean
  • grmh
  • i00
  • jhows
  • karisahome
  • kibana
  • library.crockantenas
  • magyariot
  • mcbgdom
  • mknas
  • mta-sts.mta-sts.dbert
  • mta-sts.patti
  • mta-sts.westerlundpalm
  • number251
  • omahuoneassistant
  • pemac
  • pgse
  • pokhome
  • rafacalamar
  • sojuz151serwer
  • tatunext
  • treesap-ha
  • trippleh3
  • viniciusrodrigues
  • www.dadohome
  • yyz2sfo
  • zxian
  • 2020.attreg-registrationweb
  • acfqmwy
  • adiizdzd9z8dz
  • ambvetppm
  • ashzafhome
  • ask16659
  • asqwk2
  • ausoqnif
  • bavkwodlmj
  • bellboybellboy
  • boschdrill
  • c0b4lt
  • cejeayxo
  • chan1
  • chucktu
  • claimevent-garena
  • codashop08678728
  • cpanel.2.newgarena-claimff2
  • cpanel.ambilitem-freefire-gratis-01
  • cpanel.berbagi-vidio
  • cpanel.claim-hadiah-for-garenaff-free
  • cpanel.claimsevent-ff2021
  • cpanel.codashop-freefire-gratis1k
  • cpanel.coinbased-costumer
  • cpanel.eventclaimfreefire936
  • cpanel.eventffgratis999
  • cpanel.eventfreefirenew2021
  • cpanel.ffevent2021-xyz
  • cpanel.secure5uverify
  • cpanel.xgarena.eventfree2021
  • cpcalendars.amazon-signin-87k4m11-109
  • cpcalendars.amazonconfirmationupdatehelp
  • cpcalendars.authsecu08bc
  • cpcalendars.becu01org
  • cpcalendars.claim-carte-terbaru-2021
  • cpcalendars.claim29mobilelegends
  • cpcalendars.event-notnot13-kuy
  • cpcalendars.event-skin-kulgarfregrskkn
  • cpcalendars.goblok.subscrebchanelarif
  • cpcalendars.gratistopup.promocoda
  • cpcalendars.grub-new18
  • cpcalendars.grupbkpjoinviralsc
  • cpcalendars.home04server
  • cpcalendars.spinfreefirejune
  • cpcalendars.vipsexyhotgrupgirl
  • cpcalendars.wagrupx13
  • cpcontacts.amazonconfirmaccountactiviti
  • cpcontacts.ambil-hadiahmu-disini
  • cpcontacts.claim104codashop
  • cpcontacts.claimevent-terbarujuni2021
  • cpcontacts.ff-vipcoda2021
  • cpcontacts.gabung.grub-tante18
  • cpcontacts.pubgmxsuits0283
  • damtrafikbt
  • danieldosen
  • dheohnew
  • dobpqrsstz
  • dream2
  • dvrbego741
  • eaquantumhq
  • earth.white-v
  • ebookusey7q
  • efasab
  • encomdo
  • esmigma
  • estebanb
  • event-882
  • fabiocamere91
  • feeds.moreira
  • filmmeilleus4c
  • fortuno
  • fqingazure
  • freehk2019
  • fusion.samcro1967
  • fzl768k
  • gaxoswof
  • glntdisinfection3
  • godcome
  • grup-viral18plus
  • gygkrtkmna
  • hoyashome
  • hsh
  • htfiles
  • hungduong2
  • icebreakers
  • iesdomotica
  • ikjwgisyaz
  • imsbdnprxz
  • ivydrive
  • jagqhqxgud
  • khhsu
  • kjlandrum
  • klikgarenaeventterbaru-freefireenews2
  • leateti
  • leilrbadek
  • leivafree
  • leonreino
  • leventgelir
  • mail.ambil2.evenfreefire2
  • mail.claimmmm
  • mail.claimsevent-ff2021
  • mail.claimsevent-freefire1
  • mail.codaaaevent21
  • mail.eventgratisasli542
  • mail.lucky-spin-2k21
  • mail.mystericlaim2021
  • mail.rektbagidiamond-limited
  • margaretaa
  • mc-jake
  • mkthome
  • mkviiiuttt
  • myeworvi
  • newgrups
  • nieder
  • nonaligned
  • nonnarosa
  • ntechcloud
  • nzqkqdcfln
  • obeyed.white-v
  • obmarma
  • overseerr.samcro1967
  • pammartinielloviadefilippo-csbackup
  • pnahome
  • proyectoz
  • putaxuuh
  • quitekgui
  • qukontic
  • qwerty0uk
  • readtxzdt
  • rrisuluxwg
  • ruotafonica
  • secure-cashapp.secure-1
  • serv2cntcomsur
  • shipefarm
  • shoaling.red-v
  • sifedi
  • siqinformatica
  • soulcloud
  • strepo
  • superpadova
  • tertulia2020
  • thmovymda
  • topupcodashopggratis
  • ttyrdtfc
  • vestige.white-v
  • video-japan-sarah-turner-lpx
  • webdisk.amazon-signin-87m11-118
  • webdisk.amzon-signin-8194mkvb2885
  • webdisk.amzon-signin-8194mkvd-871
  • webdisk.claimlootcrate-firefreenewss12
  • webdisk.claimshop.ff-claimitemgg
  • webdisk.codashopevnt21
  • webdisk.direct-third
  • webdisk.event-freefire-vvip-12
  • webdisk.garenaeventfreefire2021
  • webdisk.groupyoutubers-ff
  • webdisk.hadiahkulgareventterbaru-2021
  • webdisk.secu07user
  • webdisk.serv-rectznbnk
  • webmail.2.new-garenaget2
  • webmail.chatwatshap95
  • webmail.claim-events2021
  • webmail.event-kulgar-74
  • webmail.event-notnot13-kuy
  • webmail.eventgarena82.xnoth
  • webmail.ff-eventgrts55-com
  • webmail.myaccountserviceupdates00
  • webmail.redirect09
  • whytcmortv
  • wilopi
  • wireguard-cackle
  • www.claim.item-gg-old-new
  • www.king.hostinglivee
  • xxmsarah
  • ycmnmltilp
  • yubolgox
  • zenshiatsu
  • all-dente
  • alsd
  • carmursteel
  • casavila
  • chenzha
  • danhagn
  • fa4racersacc
  • frantic-home
  • halory
  • honkasalo
  • hsmtt
  • iotautomation
  • jesusabad
  • joshnet
  • lerflaten
  • lurchmqtt
  • mariozelaschi
  • mattv
  • miralthor
  • mta-sts.mta-sts.mvohass
  • mta-sts.mta-sts.vankemenade
  • nossolar
  • omv5media
  • reticulum
  • roshanx
  • sfsecure7xb21login
  • webmail.bfksb
  • wrohome
  • www.tefidocs
  • zacharhomenetwork
  • adally
  • adasath
  • adjusttemps
  • agugbmoe
  • agunrahman
  • archsecurebox
  • ateruya
  • bakerplex
  • bokepterbaru-2021
  • borgemarka
  • bysxdjpybc
  • casagraniti
  • cedmondson
  • cpanel.amzon-signin-817kvb283
  • cpanel.evennt14z.crateold43
  • cpanel.eventclaimy
  • cpanel.eventfreefire-claim-2021
  • cpanel.kuwshdc0d-238d023
  • cpanel.video-terbaru2021
  • cpcalendars.aleioiyuafakcacs
  • cpcalendars.claim-events2021
  • cpcalendars.coinbase-accfdlck
  • cpcalendars.event-trueid-claim-free188
  • cpcalendars.knalpotdosmuffler
  • cpcalendars.pubgeventsmobile
  • cpcontacts.amzazon-webapps-confirmasion
  • cpcontacts.citizens-secureactivity
  • cpcontacts.claim-free196
  • cpcontacts.claimneweventxyz
  • cpcontacts.codashopfreenow5
  • cpcontacts.even-freefire-gratisgg72
  • cpcontacts.event-codashop.rhamadan-2021
  • cpcontacts.eventffgarena072
  • cseezu
  • cyhsty
  • defcon
  • dellakutty
  • descargar-directx-12-para-windows-10
  • dorcope
  • eastgame
  • efestrk
  • eiftyha
  • eramodomotica
  • eskerriska
  • espousals.red-v
  • euhafvum
  • event-garena65
  • flds
  • flow16
  • flytechzw
  • globexdilint
  • halsall-jellyfin
  • hassaway
  • helheimserver
  • hfish.salvasacie
  • hjzivqsytc
  • home01server
  • homemcy
  • hytwjpzilv
  • iazfporegi
  • iczznow
  • igneous
  • iklandimanol
  • ilennut
  • jeeiuvugp
  • kayeeddie
  • kimhshome
  • kn92t
  • kpc3
  • kpi4
  • kyledhardison
  • langpo56ra
  • lasxdh5
  • laurapt22
  • laurensdehoorne
  • leandrovignoto
  • mail.event-spin-lucky-royale
  • mail.evnt-claim-75
  • mail.grupbokepahwa
  • mail.larenxpubg
  • mail.lukyspin-event-2021
  • mail.msteryshopfreefire
  • matthewchu
  • mertoskimerdo
  • momokudiationu
  • mondotosz
  • monitor.gost-home
  • mpgloja
  • mthogressy54
  • na-home-assistant
  • nazalnut
  • phanrouto
  • phelton
  • ptlivrosc1se
  • pwflnegjic
  • r2-harinet
  • riolisi
  • ripdownroc
  • roachii
  • robrobox
  • rx70home
  • secure2dverify
  • senidi2021
  • service-pp-restore
  • shitpile
  • siedle
  • smiikrmiha
  • sniish
  • sqoqgrdfqa
  • thinsrening
  • torwoodnet
  • tretemmam
  • unsuthi
  • vellason
  • webdisk.claimevent-ffofficial
  • webdisk.claimffevent
  • webdisk.codapay-gratis142
  • webdisk.codashopff-getnow11
  • webdisk.coiinbase-signin
  • webdisk.eventolddff21
  • webdisk.freespinenewlucky2
  • webmail.antibot2021
  • webmail.claimcratefreefire-vvip08
  • webmail.claimdiamondcomff
  • webmail.claimevennt4.crateold43
  • webmail.event-freefiregratis2
  • webmail.free.claimgaiss-mumpungpromo2021
  • webmail.log-in-to-my-account
  • webmail.securrevcc0
  • whisecna
  • wiitawa
  • windmeter
  • www.codashopp.codashopindonesiaid
  • yatessprinklers
  • ydkopwisfm
  • zdjhhfayki
  • a8d8czz
  • aanton
  • absolutefour
  • brunneis
  • canalla
  • cantalupo22482
  • catflix
  • cerro-ha
  • controllocasa
  • domofabryr65
  • efdejot
  • evilbox
  • fivestar
  • gsus
  • gutmann
  • jbeira
  • khoj
  • kirby64
  • labbee
  • lersjon
  • lhmngwy
  • littlewarden
  • madmg
  • madomsb
  • mangpor45
  • mta-sts.bigip.billchurch
  • mta-sts.cytrynka
  • raydellcloud
  • rikwithnoc
  • rpirpi2019
  • shop.smjjang
  • smarthomeuser5
  • tvideo
  • viacampagnola40
  • wangchun
  • 3bannercctv
  • abconrules7590
  • adilaslam
  • albi2
  • apandal
  • api.onroque
  • aschmid
  • ask26690
  • begotten
  • casaesplanada
  • cegiflin
  • chat.kilin
  • cilantro
  • claim229freefire
  • clasher03
  • clvqakbdjq
  • codaashopkp
  • codashop-spesial-lebaran
  • colbertjonquil
  • cpanel.aleioiyuafakcacs
  • cpcalendars.claimff-luckygratis
  • cpcalendars.free-skinff
  • cpcalendars.jurus10
  • cpcalendars.paypalslimited-account
  • cpcalendars.vip.claim-event-freefire-new-2021
  • cpcalendars.wagrups20
  • cpcontacts.amazon-signin-87o11-102
  • cpcontacts.amz-updatedetails465
  • cpcontacts.berbagii
  • cpcontacts.codashop-kulgarinfo69
  • cpcontacts.event-freefire2-com
  • cpcontacts.eventtersembunyi-01
  • cpcontacts.ff-codashopnew-2021
  • cpcontacts.newclaimfreet
  • cpcontacts.viralawekmalay
  • dahary-pi
  • dyvpn
  • espcraft
  • eur0
  • feforhe
  • ffilmt3ef
  • georgiana
  • glfamily
  • goddardserver
  • hhloftja
  • host-wellspage
  • i7hsafhf
  • iijavqicccgq
  • inesferragudznk
  • ivgxztofxk
  • iw6cae
  • jcdaydomotic
  • jordangratis.allitemgratis
  • kkihg3z7
  • kordtocu
  • lasx2ri
  • lehealthrunge
  • lessdisecal
  • llosrb7
  • mail.bkpchatjoingrupfb
  • mail.bug-codashopfree-1
  • mail.eventgarena2020
  • mail.ff-ambilbundle-2021
  • mail.nano0147
  • mail.secure7everify
  • mail.spin-2021-garena-free-firee
  • mail.useraccntbec
  • mairita
  • mattoncinifamosi
  • motomoa
  • mta-sts.bens-home
  • mustiandtht
  • nesho
  • nextduck
  • neysupo
  • nubefernando
  • officeloginauth
  • onstyle-sdc
  • pajkosponi
  • pizylpdgfa
  • praxislasrozas
  • pziegtrzxz
  • qjsigea
  • rigryro
  • roselt
  • roy-family
  • sabnzbd.mrgiz
  • swantitu
  • syraasa
  • tedephal
  • teljl
  • testdoang55
  • umvxofeoiw
  • unraid-sieys
  • vbjxrmdban
  • vdmxqtmynn
  • ventbermoong
  • video-japan-betty-hernandez-rkp
  • viwgasfhgf
  • web.minionsofhonor
  • webdisk.4wsrfhg6wr45f
  • webdisk.choda-shoopgg
  • webdisk.claimfreeskinmlbb
  • webdisk.claimz-event-old
  • webdisk.free-langka
  • webdisk.jamalchairul
  • webdisk.topup-freeeff
  • webmail.codashop-ff-45
  • webmail.eventbundlefree
  • webmail.xxx18new-com
  • whm.event-freefire-daimondg
  • wp.dolcesbone
  • www.duckdns.orgwww
  • youtubedlg5900.namong79
  • zeppelinamckeever
  • diepollys
  • dinonet
  • gui-nina
  • nqgggtxyqg
  • pepsicolestv1
  • vhhuannmbo
  • wariherb
  • configuratorrp.bjornerod
  • cpanel.groubwhatsappbokepviral
  • cpcalendars.log-in-to-my-account-secure
  • crashtec
  • evanbills
  • gamelle-api.wcs-lyon
  • grup18hot.grupbokepbaru
  • jackfeathersword
  • jirblrbdba
  • k4nzi
  • kelvinty
  • lindetiszaujvaros
  • macenacentro
  • mail.eventvipp-2021
  • mail.gcoddashoop
  • mail.item-free-zx23
  • qdnizfhjhc
  • redem-itemgeratisff
  • slqwzjypca
  • urgbtknbfp
  • uytiytiyti
  • webdisk.amazon-signin-871jum44t1-184
  • webdisk.codashp-ff66-com
  • webdisk.klikeventff2021
  • webdisk.mlbbstun515-newxyz
  • webmail.2ws6rth146w5s
  • webmail.event-terbaru-free-fire-2021
  • webmail.joingrupwa-notnotterbaru
  • www.claim.eventgratis-com
  • www.play.mobilelegend.event-515party
  • balaha
  • cadutruss
  • devilfp
  • fldohassi
  • gvhospital
  • homeassistantjensmueller
  • majestika6
  • pbu80
  • stamatoukos
  • vdyqpqbvgv
  • anonnomi
  • bongonation77
  • cpanel.chatwhatsaapjoin2
  • cpanel.fulldurasigrupwa87
  • cpanel.online-seucre09v
  • cpanel.skinmllbbfreeht
  • cpcalendars.coodaashiop
  • cpcalendars.eventgratisfreefire060
  • cpcontacts.codashop23
  • deidriv87ic
  • eventcodashopgratis1633
  • imeed
  • mail.claimeventgarena23
  • mail.linkgrubwa
  • mail.newml2021.newfre-17
  • notcarlsagan
  • portainer.abdullahsamir
  • posttravef
  • pqitie
  • signnicons
  • webdisk.2.claim-disinireall9
  • webdisk.applepage-profileme1
  • webdisk.codashop-event11
  • webmail.event-spin28
  • xepuhyuzh
  • 283000
  • arcodepuauberaba
  • baconsult
  • beauhill
  • faberhome
  • h0st
  • isytechomeassistant
  • korbendallas
  • mta-sts.mta-sts.jozlo
  • norms
  • plzhome
  • pooltestpire
  • spil-obs
  • stvnoha
  • thingrunde
  • vrata
  • vrunx
  • acizin
  • baileyg
  • bbntd9
  • cikloid
  • claim.codagmes
  • cluthegrid
  • code.feangol
  • cpcalendars.evennt5e.crateold43
  • cpcalendars.freeefireeeevetttt
  • cpcalendars.lukyspinff-ggterbaru-2021-9
  • cpcalendars.pubg-mobile-22
  • cpcontacts.vipevennt12.createold3
  • dkaz
  • domotica-damico.duckdns.orgtttttdomotica-damico
  • dssd
  • fuxkvbsr
  • heiden
  • homeassistant-yannikschirm
  • jardiance
  • jghoxoxduh
  • jlrftp
  • kjiudbzn7
  • kkihg4k7
  • lylikind
  • mail.spin-gratis-8904
  • nas.greening
  • ovfira
  • qrcridzqow
  • rcye
  • redepisos-centro
  • s1px0s
  • samquiznew
  • semp
  • sync.tollerpi
  • traefik.ts-server
  • uezjwyahnp
  • vill01
  • webmail.2yfutfjvhgdh
  • www.xxhuzz
  • you-video-japan-psmlcl
  • zeehome
  • zyecwjtdrt
  • abnet
  • cikotahomenetwork
  • jocnas
  • aghwirelesscg
  • cpcalendars.02becu-home
  • cpcalendars.onlineverfy-usrseucre03z
  • mail.ggclaimgrenaa1
  • antomhome
  • bholdher
  • citar
  • educasa
  • wordpress-leah.myprivatenas
  • mail.freefire-eventnew
  • shrigga
  • webmail.secure9vverify
  • jochen-nextcloud
  • mattas
  • secure5lverify
  • collabora.luzipuz
  • cpcontacts.hanyasaja
  • hfz
  • shutvalidcastledown
  • tasbws
  • webdisk.skelandlee
  • ksjuit
  • quakda
  • mail.bugcodashopggz1
  • 894
  • bull0592
  • homeassistant013
  • ruigo
  • rubus4
  • core30
  • ts-bastiani
  • cpcontacts.2.claim-disinireall9
  • cpcontacts.verifications-identity
  • derseb90
  • masumordek
  • mail.18pluss9
  • casacossa
  • dchard
  • fkxw7rfpcv4f8o
  • wattengard
  • alsn
  • cpcalendars.spinhadiahmufreefire
  • cyberion
  • freeradioprovo
  • ixl-b
  • strecj
  • tlvtuelybc
  • webmail.mxi0e20r2-2iejdoif2
  • xexvgc
  • jjhome17
  • webdisk.mychasere
  • wgianbzipg
  • dawis
  • sg-ha
  • tahiti
  • cpcontacts.event-pubgmobile-2021id
  • ecuado2021
  • googlehash
  • hoihmakqwn
  • belous
  • colonos
  • pascalis
  • vincyhome
  • argentonameteo
  • danigay
  • medinahome
  • nextcloud-maxoal
  • nfsjolglqk
  • sarhlade
  • webdisk.freeclaimevent-freefirefirenews27
  • webmail.secure4tverify
  • wwwwww11
  • anacreontic
  • casadiminoefatima
  • maintell
  • mta-sts.hohm
  • oneeightytwo
  • webdisk.holiday-bookings
  • cpcontacts.codaashop-bug2021
  • hahnhome
  • jpolxc
  • killb7ii
  • km3
  • webdisk.eventclaim-freefire2021
  • pan-home-ha
  • cpcalendars.eventlootcreate-garena1
  • cpcontacts.ffevent-freespin072
  • lucky-spin2021news
  • mail.claim-itemoldgg-2021-1
  • webdisk.freeff-event
  • webdisk.freefire-cobra2021
  • www.c25
  • mta-sts.tekehome
  • mail.event-cleim-old16
  • cmos1
  • aneip
  • ultradinosaurspace
  • feibloomto
  • mail.kurirbukalapak
  • mbghosting
  • sheepcloud
  • 2019.huntyhassio
  • adb-https.orcvnc2
  • mail.luckspinff999
  • siphokhoza
  • cosme18dejulio
  • androratkes
  • cpcalendars.restart-mynetflix-services
  • xxvolueq
  • casetadelrio
  • mail.newfcoodashop
  • webdisk.spin-bundel-old-free-fure
  • jrvillagalas
  • rtb23
  • skymaxis
  • 1728daemon
  • 184
  • 1free-shadow-robux-l00k
  • 3fmunoz
  • 4klunix
  • 6466
  • 6martin
  • 81fm
  • admantium
  • albter00
  • alxr19home
  • ameb-home
  • amunendii
  • anic14though
  • antonha
  • archedrapier
  • archgraphic
  • arikue
  • arionkosturi
  • artha
  • astroviking-plex
  • auth2appleidrecovery7
  • autodiscover4owasecurelogon
  • azikiwe
  • bajavision
  • barbary
  • barkershome
  • barwickaw
  • bastienha
  • beamers
  • bennetflix
  • bernstein
  • bhoweremote
  • bizzlee
  • blomgren-home
  • blunex
  • boesj
  • breanne
  • budda81
  • buzznet
  • bw.manishome
  • caracbisi
  • carlospaedhome12368
  • casadc
  • casades
  • casasimo
  • casatranquilla
  • cernipige
  • certyx
  • chew
  • chiahome
  • clarabell
  • club4288
  • cnnremi
  • code-t
  • codycato-octoprint
  • cohenfamily
  • connec321-hostdomain
  • cpanel.75-73123768
  • cpanel.japanese-hot
  • cpanel.mtq0ndqynzo
  • cpcalendars.service-amazon
  • cpcalendars.webokayceedocusign
  • cpcontacts.loglnitmeqrinomixcrozost0n1ine
  • credit-agricole-dsp2action
  • cripto-wdn
  • criticalcreative
  • csshomelinux
  • cubeserv
  • cuspis
  • cyanlabs
  • dducarme
  • debendevanbokhoven
  • delted
  • demitri
  • denizbu
  • descargar-metal-slug-1
  • devcenter
  • dokushokaizoku
  • domotica-tizi
  • dtklassenha
  • edgard-tarquin
  • eisenschmitt
  • ejr1
  • ericahlers
  • f0d9f282-7ed9-4739-927e-c35810195ed7
  • familiereedijk
  • felixhome
  • fhjhll
  • fifernet
  • filmr.laoss
  • flinman
  • fooha
  • forse
  • fortwachter
  • fourwaysnextcloud
  • gajdlziy
  • geiser
  • georgeha
  • ggubatti
  • gian-home-assistant
  • gijmelberg
  • giotm
  • gohassio
  • googlechormetroll
  • greyteck
  • grifs
  • gymanishere
  • h-family
  • ha-diploma
  • haalexa
  • haraldw
  • hascorn
  • hassiocatr
  • hgter
  • holderman
  • home-jsp
  • home-stroma
  • home-sven
  • home519
  • homefabio
  • hongtrantrendoicanhtay
  • hptid3
  • husserv
  • imohsenb-hassio
  • incolumis
  • ineedtobiesd
  • inmarmu
  • ipv6.demoman
  • isuperhouse
  • itsec
  • jewpwe
  • jmailhq
  • joemyers
  • kaplan505
  • keinegnadefuerdiewade
  • knollenberg
  • knowledgeflow
  • koloredika
  • kontouberprufung-paypai-1a2y61r-166
  • krupa
  • kubrt23-hass
  • labayyav
  • laelo
  • lauatkr
  • lavasponge
  • lemmoathome
  • littlefinger
  • locmess
  • login-outllook-mlcrosoft
  • lopiefsdea
  • loukaniko-bitwarden
  • ltbfpxmkxf
  • mail.92-49748575
  • mail.faxing-online
  • mail.loginimgrin0nnixcrosofs0nl1ne0nline
  • mail.mkgf
  • malakmt
  • marcossilva
  • marinaautomation
  • mathieu-nogaret
  • mchelancelo15
  • mdwebber
  • memaygg
  • meteobianya
  • metin2kurban
  • meuhassio
  • mhnet
  • microsoftoutlook
  • mifhasio
  • mihogar9330
  • mijerrj
  • misuaste
  • mmedrano
  • montberthome
  • mostally
  • mta-sts.andyv
  • mta-sts.betterdivepro
  • mta-sts.chanchal-ha
  • mta-sts.cpanel.kuldhara
  • mta-sts.dallaireanglais
  • mta-sts.dokha
  • mta-sts.doq-test
  • mta-sts.guineueta05
  • mta-sts.hasszero
  • mta-sts.homenunolevina
  • mta-sts.leetleet
  • mta-sts.lordkaladar
  • mta-sts.lyonsontucker
  • mta-sts.mta-sts.erikmartin
  • mta-sts.mta-sts.familievale
  • mta-sts.mta-sts.foughtha
  • mta-sts.mta-sts.impire
  • mta-sts.mta-sts.jcte
  • mta-sts.mta-sts.jeed
  • mta-sts.mta-sts.leemyungbak
  • mta-sts.mta-sts.leiblair
  • mta-sts.mta-sts.linkit
  • mta-sts.mta-sts.metbacken
  • mta-sts.mta-sts.multiholle
  • mta-sts.mta-sts.myalfred
  • mta-sts.mta-sts.nigeldesouza
  • mta-sts.mta-sts.nkulm
  • mta-sts.mta-sts.stevenshouse
  • mta-sts.mta-sts.studiomore
  • mta-sts.mta-sts.synapsensalat
  • mta-sts.mta-sts.thefullabw
  • mta-sts.mta-sts.timknhassio
  • mta-sts.mta-sts.tygercraft
  • mta-sts.mta-sts.vagosvalente
  • mta-sts.mta-sts.vpnkitty
  • mta-sts.myjava2
  • mta-sts.nextcloud-raspberry
  • mta-sts.potatis
  • mta-sts.rconsolidated
  • mta-sts.red-home
  • mta-sts.rjc
  • mta-sts.sear-x
  • mta-sts.securecloud
  • mta-sts.serverc5
  • mta-sts.smartlodge
  • mta-sts.thebeechens
  • mta-sts.toilatoivaemlaai
  • mta-sts.webdisk.xixam2
  • mta-sts.wenlong
  • mta-sts.zauberstuhl
  • mukesaso
  • mulinu
  • mvfsctuxalyk
  • mygirlfriend
  • mylink-secure-cars00-com
  • myns
  • n2ruu1pwuwl
  • najjadas-omv
  • naturesbest
  • nextcloud168
  • nhatminhhtd
  • nicksawiw90w92hwklw9akqw9wjkwo
  • nns206
  • nonpracol
  • nv-azure
  • nxtst
  • olderas
  • oobe
  • osky
  • oyintare
  • pa1gupta
  • parcel
  • patrickwjoyce1
  • pbtha
  • pdhhwqpqaujuwp
  • pebe
  • phichewa
  • phillocasa
  • pippodepipperis
  • planetexpressserver
  • plex.jacklikea
  • plex.kimura2
  • profit2u
  • pupuns
  • pvecloud
  • qbitron
  • qwerqwer2
  • qzfvkhxtsio
  • rand
  • randarnet
  • rediraccount27641
  • relaxmcsiqer
  • riobeto
  • rnf
  • robond
  • rosscloud
  • s0
  • s15pubgm
  • samatgk
  • santihome
  • sbrooks
  • seanshome
  • secure07-support
  • sellersaj
  • serversss2
  • servidor9513
  • sfdsfdds
  • shacksonarr
  • sibul7
  • siebenbornnextcloudpi
  • sifes
  • singleump
  • sinhome
  • siti
  • sjva.analogic
  • skullprogrammers
  • smoketest
  • snapbot-gw
  • solicitacaodep13
  • soundfree
  • sp
  • spinspubgmobile
  • spootnif
  • spower
  • stealbey
  • strategix
  • studentshelp-63279
  • stymiestnanaimo
  • subburam
  • sumfin
  • sumuklu
  • supportcentrerecoverymyappleid
  • swallow
  • swdowe02
  • tercy
  • testnuc
  • thehab
  • tonytwobits
  • tor64
  • trinka
  • trs3615
  • tungnpl
  • tyjgjqrdcqt
  • uallabag
  • ughly888
  • unitedmail.unitedlabdc
  • unraid-server
  • useprivact22
  • vendelierstraat10
  • vereinsheim
  • verifyusers001
  • vialire
  • virtbooycb
  • wanwyhqso
  • webdisk.getskinn
  • webdisk.lamtinhnhe
  • webdisk.secure7a-apple-verification
  • webdisk.vidoe1232
  • webmail.bamls
  • webmail.brightwel-service
  • webmail.foodcolor
  • webmail.fsdgjk
  • webmail.por-ngirlcrazy
  • webmail.rbmfnoji6mt
  • weifengshe
  • whcfnsculr
  • wolfpackha
  • wowstreaming
  • www.6-472432306
  • www.aboas
  • www.adventureleader
  • www.fastblinker
  • www.free-porn
  • www.gga1200
  • www.malinah
  • www.new-eventpb
  • www.opiespank
  • www.secure-customerlog
  • www.snyvle
  • www.thuandeodep
  • www.wetransfer
  • www.wiki.brutalrelax
  • www.wkjo
  • xbyboe
  • xfwsckuo
  • xhsullefub
  • xj93mc-c4934f-f9n3u49f3if34f
  • xoackimchis
  • xplanes
  • xudex
  • xyycjkdymr
  • yadgartech
  • yfdeman
  • yjaleuenku
  • ymncgglcal
  • yourock-test.angservices
  • zcdtogkejh
  • zgasaumecn
  • zhuohui-home
  • 132cobblestone
  • aakslsmalajsdkdksmmassd
  • ahtoh
  • akara-fwa
  • albertdomoticz
  • alexa-matejka
  • auth62
  • bazarr
  • benjinextcloud
  • berkel
  • binnitho
  • bloodscar
  • broganswarehouse
  • candccloud
  • casapacedro
  • casasasi
  • catchinganautist
  • cleanssddemddiiopssewuio
  • cloud-next
  • cloudbridge
  • cloudstorage3
  • cpanel.xn-eu-cloud-network34-xn-c-55xn77a
  • danyel
  • dasdsasavsav
  • dashbd
  • defaltroot
  • destachiotek
  • deweerd
  • dickeysbbq
  • dinof
  • diver86er
  • drennen
  • echowatch
  • ecsportal
  • emeraldhorse
  • eropchar
  • evizle
  • fatimike
  • floutef53rus
  • fphx
  • freakyfreek
  • freeshop8
  • ftsystems
  • garciahome
  • gphass
  • gr0upbokep-wa1
  • hatill
  • hosung
  • huisjeboompjebeestje
  • ickswyllm
  • itauline8
  • join-my-grup
  • juflindsey
  • juliocastrol
  • kilda8
  • krzyho
  • kvbmha
  • laborde
  • lancrosis
  • leo60228-hass
  • lessevil
  • lidarr.mousemeat
  • llultrall
  • local-manager
  • loggingonlinemicro
  • lwyk
  • mail-nepalgovnp
  • mail.258966547896547896
  • mail.account-security-update-alert-secure09
  • mail.accountverification
  • mail.decore
  • mail.flizaa
  • mail.secur395chas3e
  • mail.sendel
  • mail.undergroup
  • mail.update-details-cha06b-security-auth
  • mail.update-web-secure05-wellsfargo
  • mail.vietnamne
  • main.et-40ne-home
  • manahan
  • mantarawark
  • marienkarels
  • master-race
  • mdkuhtiy
  • meastp
  • merkara
  • michalw
  • minidnsme
  • mirabellenextcloud
  • morsinknextcloud
  • mta-sts.7woodgate
  • mta-sts.cc-rpi3
  • mta-sts.dell-nas
  • mta-sts.domojesimo
  • mta-sts.file.ki3lich
  • mta-sts.firechrome
  • mta-sts.ginoshouse
  • mta-sts.gkatsikhs
  • mta-sts.glory12
  • mta-sts.grantmac
  • mta-sts.hassao
  • mta-sts.jagthornslaug
  • mta-sts.mta-sts.bogdanalexe90
  • mta-sts.mta-sts.casadeden
  • mta-sts.mta-sts.cloudfoo
  • mta-sts.mta-sts.codenamej6
  • mta-sts.mta-sts.cthor2
  • mta-sts.mta-sts.irenee
  • mta-sts.mta-sts.jguillo
  • mta-sts.mta-sts.lowchansaechao
  • mta-sts.mta-sts.middlehill
  • mta-sts.mta-sts.smolz
  • mta-sts.mta-sts.zyrmpg
  • mta-sts.nextcloud-soyouz
  • mta-sts.progressive-inktattoo
  • mta-sts.rabbitfed
  • mta-sts.servidorfrancia
  • mta-sts.sherwood
  • mta-sts.tboned
  • mta-sts.thesouthplace
  • mta-sts.wedmanthuis
  • mta-sts.westin
  • mta-sts.www.castcast
  • murillohass
  • myhassio-thuis
  • myhomerz10
  • mylackdoktor
  • mypersonaldeveloper
  • nasbat
  • nbhuu
  • ncks
  • nextcloud-mrpingvin
  • ngayaydauroi
  • nicolascipollone
  • nordflix
  • of-108-fw-portal
  • ogajkfmypq
  • ordzzer56484
  • oshax55
  • otdyh-home
  • otto-home2
  • ov7ef6aw3
  • paypaldeutch-relitrclosehandle
  • phludde
  • plex.gusal1984
  • plex.lex-malyshev
  • plex.perrier
  • pogiollishome
  • presad18jadb
  • proyectoresidencias
  • pubgmeventx14
  • qgqvghcrvz
  • qurans
  • raehass
  • raven-nas
  • rdkcuyqolx
  • renstec
  • ricicaunifi
  • robertmpfw
  • romanempireftp
  • root-cloud
  • roots
  • rybitskisonarr
  • sduyfg2hf-fh7340-f784
  • secure-domain-25auth
  • secure-now6
  • securebora
  • seets
  • shane-server-bitwarden
  • silvatec
  • skilbjo-api
  • sn-efaxonline
  • sngcontactinfo
  • soderberg
  • sonarrgary
  • sorsuu
  • ss0-securehost-nov13-5
  • statyba.cobens
  • stenapse
  • stollen16
  • stroevehome
  • studbay
  • susecurechasn002
  • tbrock
  • teicasa
  • terminal-cine
  • test1.kiralex1995
  • tommyvange-plex
  • totalautomation
  • traccarlocal.jakdec
  • travel6655
  • tullgatan5
  • txt
  • udden6
  • uec618
  • ulichat
  • update-account-billing-recovery2
  • uswbmail-163mail
  • uzoi49555uaecsjedpprh2gxn4mnatxk
  • viperrus
  • vloev
  • wade2014
  • wbwjxoqocuw
  • webaps-masterloh-xcofvid19-z0aia0yi9c6jw
  • webdisk.adminnewprodata
  • webdisk.bokepvirl2020
  • webdisk.facebookz332
  • webdisk.marva
  • webdisk.update-detail-cha06d-security-auth
  • webmail.amsamzon-cloud-network54-xn-c-9874865
  • webmail.auth-paypal-limited-session0xc740c
  • webmail.bethy
  • webmail.chichconcugay
  • webmail.memb-ership-restart-net-flix
  • webmail.multlplefalledaccess-unl0ckvalldate
  • webmail.paypal-accountsecurity-login
  • webmail.secureo07-support08-accountsecure-info
  • webmail.sexygirl157
  • webmail.videos-hotgirlshock
  • webmail.webokayceedocusign
  • wegood
  • weriut
  • whatsappx19
  • whd0603ora
  • whmonline
  • wuwa
  • www.account-imformation-update-review
  • www.app-id-verification-required
  • www.gm-mqtt
  • www.info-service-onlinee
  • www.m31server
  • www.meuabrigo
  • www.pekkyoze
  • www.sec0c-chas04-update0-online
  • www.sexygirl173
  • wyiwedocgw
  • xeugjelfpy
  • y8n9d903n83nd9fn83hf93nd9feof3ofn93
  • yankke4
  • yk9pu6ad
  • zammuto
  • zeptekon
  • zsalfxdyto
  • 1lflsg-0005xm-4
  • casami
  • cpcontacts.free-event-freefire
  • drongense
  • hebilli
  • j3dd5
  • jachama
  • 18897
  • 215gren
  • 275019
  • 2x897asf9a8shffas
  • 9-065802844
  • aakakaaapapwwweoeowwpwp
  • aeronautical5707
  • aeroplanuuusdpokll
  • airflow-osuarez
  • ajabele5
  • ajuglandnextcloud
  • ak1rajellyfin
  • alreadyhome
  • app.elmoubuntu
  • apt21hassio
  • archelonbitwarden
  • archernet
  • audiobook
  • auth-membership-pay-palacct
  • authhijakobi
  • avm067s
  • awesomenzbhydra2
  • azitonthte-lersrvdenovh
  • baimwong10
  • bakupnewxtrm
  • bchoor
  • bdvamqvjop
  • beeserha
  • beeshive
  • befgtmmnbp
  • benzettamaxki
  • bestweco
  • biocloud
  • bitwarden.shadowdare
  • bobodraganov
  • boi365online
  • bokebtantewhatsapp
  • bookmark82
  • bookstack.apollohome
  • budihome
  • buntic
  • callegaldi
  • campanes
  • campoy
  • canforatdecuc
  • casaprieto
  • ccn.efeffe4g5rggrhgth
  • cha5esupp0rtacc0untresultunlim1tedd
  • chan-family-serv
  • christian-office
  • cmbldc
  • conchanclas
  • connectsecurewells
  • cpanel.codewe
  • cpanel.hellorep0rtsunusu4lact1v
  • cpanel.idstore-manage-apple
  • cpanel.secure-well-fargo-update
  • cpcalendars.b9q9le
  • cpcalendars.squarespace-adminstratorkolofcg
  • cpcontacts.w1qa
  • cpcontacts.wounded2
  • cuttleconstructionin
  • d0r1k
  • d2l6yxjkc0hvbwu
  • dadidomotici
  • dashboard2i0bv5t-socialsecurity-gov
  • dashbord2ddf8w-chase-com
  • dbs179homeassistant
  • dbs6c
  • dnykjbkffs
  • dojo133
  • domekcloud2
  • druidunraid
  • dsc-meet
  • dtw0colla
  • elmohomeassistant
  • escanorlidarr
  • famiano
  • fermimn
  • filebot.ks2
  • firstapr3
  • flashrocket3
  • floydheld
  • fls-na.amazn
  • fnchassio
  • fosterhomenetwork
  • foxy-tv
  • frostfestival-event-limited
  • fvugttgsrr
  • gaypai
  • gezb
  • gibland4nextcloud
  • gitlab-code
  • godaddy-marnewging-3
  • goosehome
  • gordonthepi
  • gr0upbokep-porn-indo
  • grafana.turingcoffee
  • greehass1
  • guyvdb
  • ha.danzonefoobarbaz
  • hackertt4t4
  • hagwood
  • hakrakedal
  • harerumsp
  • hassio-sizif
  • hassio3869
  • hassiocollab
  • hassiossd
  • hast1nap0urah
  • hellsonic
  • herekingbookspdf
  • hextet
  • hirosky
  • homeassistant-rb
  • homeassistantgroovit
  • homecerraja
  • hubendx5
  • idlfo04apdl-dnc8ek4get
  • ilyowxptxp
  • inscureid-apple-cysnid
  • iris-vivescere
  • isytechassio
  • johnstewartradarr
  • joinsgrupbokepwhatsap03
  • kazth-cloud
  • kiclaw
  • krinehart
  • lenfiles
  • leo2018home
  • letsomv
  • linus-cloud
  • lmmmn
  • loralogging
  • lshrxrztnrk
  • magneticbuildingset
  • mail-wabash-net0continue93jdi3d
  • mail.alpenclioud-storaxludeaon
  • mail.haerity
  • mail.l1i
  • mail.lovezar
  • mail.secure1-mailvertif
  • mail.takawasatorahola
  • mailbox-verification
  • makojahus
  • mciosze
  • ministrysense
  • mkmirai
  • mta-sts.data.ampache
  • mta-sts.eitan
  • mta-sts.ericschwamb-summershore
  • mta-sts.fobcloud
  • mta-sts.imwunderland
  • mta-sts.leemyungbak
  • mta-sts.midorin
  • mta-sts.mta-sts.bobbopperanohassio
  • mta-sts.mta-sts.coloffdra
  • mta-sts.mta-sts.davidsworld
  • mta-sts.mta-sts.gdiuphafvzqfymbg
  • mta-sts.mta-sts.howlett
  • mta-sts.mta-sts.marcinbauer
  • mta-sts.mta-sts.sullivanhassio
  • mta-sts.pampeliska
  • mta-sts.rtos
  • mta-sts.semap
  • mta-sts.speedycrashplan
  • mta-sts.www.green-pages
  • myshitnas
  • naw1
  • nc.l4kitu
  • network-cloud-network34-xn-c-55vn551
  • nextcloud49
  • ohvtptdxyw
  • onebr2
  • onlydrive
  • oonin.chibiroar
  • organizr.renfri88
  • particulares-personasbbvadj
  • paypal.com.support22
  • pimradarr
  • poweredge-bitwarden
  • pruebablankomc
  • qesftgggth
  • qqwert43525346
  • rad-grayice
  • radarr.woodcote.duckdns.org.woodcote
  • raehome
  • rassat1
  • rcmyuvgscd
  • rkbnqsctys
  • rnrnnrnrrnrnrnmppooo
  • ruykbcdigt
  • sarlaccplex
  • sdindswhfm
  • seppomlind
  • server-emby
  • serveritaca
  • service-loginsomail03-orange
  • shell.host09.mottegs01
  • sierradeltapapa
  • silberknopf
  • sintesisrl
  • sportellocloud
  • srcvsamznwebs
  • sslos
  • stefanet
  • stephenf1
  • svyktepnlz
  • sweet-home-net
  • talkvrjevn
  • tempehomeass
  • tommydeadweightpass
  • towerpoitevinsonarr
  • trhyjukgi
  • tv.gordis
  • uhu
  • vault-sa
  • wabalabadab
  • wasim7385
  • webdisk.kivtre
  • webdisk.sexygirl228
  • webmail.secured-acc0unt-verlflcatl0n-user
  • webmail.tuoimongmo30
  • wretm
  • www.ggdhh
  • www.klipc
  • www.normalin
  • www.ofoeko5
  • www.securlty-access-b0fa-acc0unt
  • www.tools4nerds
  • x7cde
  • ypqqqdpppc
  • 00k0naknr0k
  • 186
  • 20mtauburn
  • 2ndeast
  • 3666
  • 4redwood
  • 91lovehi78767118
  • 936a
  • aerender
  • aeronext
  • aillgner
  • ale-jackett
  • angrynerdspwd
  • asi134
  • aslanoglu
  • atlustats
  • attachementnet-outlook3564-owa
  • avohome
  • awusome
  • azerus
  • bai.jtb-pi
  • bart-peeters
  • bennyaf
  • bentolisboa77601
  • bernulli
  • bittmann
  • blfnzpjvcix
  • bobonums
  • borky
  • brammerhome
  • breimon
  • bssncp
  • buscabus
  • captain-glen
  • carya
  • casagusella
  • ceimuu21am
  • celestial-temple
  • centenero
  • cgenigma2
  • chatwax
  • chomifun
  • chuccloud
  • clhome-nvr
  • cloudsdale
  • cn-home
  • cobj
  • colinallan
  • coloradodigital
  • cornell
  • cpanel.appleid-apples
  • cpanel.cu9xu9
  • cpanel.joshua-chasespaming
  • cpanel.nkshw
  • cpanel.online-bdo-com-ph-portalserver-login
  • cpanel.sexwhatsappjav
  • cpcommshut
  • crazydog
  • crest1
  • cydorfs
  • dakk
  • dancertc79
  • datingj4668
  • datingoaf
  • dcrcasasonoff
  • dcunhalab
  • dde6efefefezff
  • denis11hassio
  • dewijones92
  • dh-ha
  • dimribook
  • dinger104
  • dinocloud
  • djellyfin
  • djmario
  • docholidayss1
  • doliveira
  • domoticadimatteo2005
  • domoticakennedy
  • domus-leo
  • drsmp
  • duix
  • ecoflo17
  • edomax
  • efekhack
  • electricpond
  • elo-office
  • endoit
  • eoznet
  • erogers
  • eskildsen
  • eyeofmaat-ombi
  • farkasnet
  • fartbox
  • faulksynzbget
  • fbhassio23
  • fbhosstfacebook
  • ficusficus
  • filtre69
  • flockmill
  • foyhome
  • freak1234
  • freakyzone
  • fritolay
  • funkypuppy
  • gagny
  • ganosmarthome
  • garaffahouse
  • gcbrocketchat
  • geckeler
  • ghomeha
  • glenabri
  • gosusan
  • gregguo
  • guvbgcehoa
  • h0me-ass1tant-2989
  • ha-grevenbicht
  • ha-kmd
  • ha.eureka6846
  • haeikaas
  • hashi-home
  • hass-hammer
  • hassio-george
  • hassiofrangs
  • hassiotheo
  • hausilo
  • healthy-meals
  • hiddengate
  • home-atb
  • home-hass-2005
  • homeassistantzandberg
  • homef10
  • homewalassistent
  • hshcasa
  • huesmarthome
  • huongcamtao
  • id-apple-com-login-dashboard
  • ijehawele
  • infinitykea
  • isajrat5
  • isax
  • iz1rhe
  • jabilotocloud
  • jarvis2
  • jbiggins
  • jch33tah
  • jerhome
  • jhjaja.fry1
  • jigarkhor
  • jlc03190
  • juan-home
  • katsa
  • kaystarz-0202
  • kensha
  • kevtornextcloud
  • kh1484
  • kijqhvjbvx
  • kjellemobilverksted
  • kk2as
  • kmallha
  • kvalitka
  • lakaze
  • lambda2
  • lebensq
  • lec-home
  • lecghau
  • lengbalsubf
  • lewiatanx
  • lirowo
  • lnxwall
  • locoha
  • luckyspin-event4
  • luihome
  • luku-v-gaagu
  • macetas
  • macron1
  • mactower
  • mail.caredser
  • mail.pokshd654
  • maqcloud1
  • marckoper
  • maxrpi
  • mcbj
  • mgoody55
  • miamanu
  • miaumeow
  • millerkyle72
  • mirabellesonarr
  • molliex
  • mpowell
  • mshafiksh
  • mta-sts.alphafitness
  • mta-sts.barlogulursului
  • mta-sts.cloudak
  • mta-sts.cpanel.giang92
  • mta-sts.dfnet
  • mta-sts.dielschneider
  • mta-sts.eaglemountain
  • mta-sts.enet-ha
  • mta-sts.fischertech
  • mta-sts.frogg
  • mta-sts.hassiohuxley
  • mta-sts.ismmirnc
  • mta-sts.markuzshop
  • mta-sts.mta-sts.barroca
  • mta-sts.mta-sts.erodrig3hass
  • mta-sts.mta-sts.etcasa
  • mta-sts.mta-sts.fmheimdallr
  • mta-sts.mta-sts.geiraheim
  • mta-sts.mta-sts.gggg55
  • mta-sts.mta-sts.hobymcnair
  • mta-sts.mta-sts.mbcli
  • mta-sts.mta-sts.msantang
  • mta-sts.mta-sts.oklahomalink
  • mta-sts.mta-sts.przemek
  • mta-sts.mta-sts.thechajoneri
  • mta-sts.mta-sts.tpickens
  • mta-sts.mta-sts.unath
  • mta-sts.mta-sts.wawooster
  • mta-sts.mta-sts.weyter
  • mta-sts.niggadjai
  • mta-sts.octopijunas
  • mta-sts.plex.argyris
  • mta-sts.poolplex
  • mta-sts.rodrigo-fracasso
  • mta-sts.sarvwouldgo
  • mta-sts.subcommand
  • mta-sts.themengine
  • mta-sts.tigerflood
  • mta-sts.webdisk.clipfullhdfuk
  • mta-sts.webdisk.download-bokep
  • mta-sts.webdisk.free-porn
  • mta-sts.webdisk.hubzywm2rsok
  • mta-sts.webdisk.sofagreat
  • murphy
  • mycoolservice
  • myotto
  • napouxna
  • nas.gotson
  • nasferatuportainer
  • nathandocken
  • nc-pgvr
  • ncp
  • newsamcav
  • newyorks
  • nextcloud.mywebdrs76
  • nextcloudn0c1
  • nimks
  • node-red.rasspi
  • nubsquad
  • nxtjml
  • oam
  • ogorabqxalx
  • oius
  • olathewx
  • olegastrobar
  • olistring
  • paha
  • patschreck
  • pcraig
  • penmaen17
  • peres
  • pi3co-site
  • popohass
  • portatiljesus1
  • powerpower19
  • pro.dashmacarone
  • prod-kudos-travel
  • proxy4scholia
  • pulled
  • purlys
  • pvyparts
  • qbzzt
  • quackmire
  • radiostandby
  • raffaelhass
  • raflarage
  • rasmusthomsen
  • raulnuvol
  • rb2021
  • redirct-promo
  • redwingroadstorage
  • retronomicon
  • rgg5g
  • riedelmarkus
  • rjbegcp1
  • rlbebobkcicj
  • robandjenny
  • rsarmient0
  • rse43
  • rustybucket
  • rveoepktgrp
  • safe-net
  • sanchezymateos
  • scott-octoprint
  • sexviet15
  • sgfdhh
  • sharedataonline
  • shodanho80
  • sibtcha
  • sloane
  • songve
  • sparesandmechs
  • spargeltarzan
  • spynetss
  • storsv
  • supportcentre2recoveryicloudaccess
  • susteranna
  • sys
  • t9vzaezx
  • tetomogumao
  • thaastrup
  • theleehouse
  • theprices
  • tinsil
  • tirjunctip
  • tommyharding
  • torexcasa
  • treby
  • unraidmm-ombi
  • vandijkhome
  • vanwijkhassio
  • varion
  • vddool
  • vermive
  • victor1
  • vigorous-keller.clzero
  • villahq
  • vpn-gotzel
  • walfort
  • webdisk.chase-security-update
  • webdisk.cxcdc
  • webdisk.ln2hroji6mtuw
  • webdisk.locleptuangapubg
  • webdisk.server-otp-ontimepass
  • webmail.safeall
  • webmail.ysjd
  • wfonline07support
  • whittfunza
  • wibimwov
  • wnewpb
  • wroblewski
  • www.bfgge
  • www.hcomet
  • www.hgvpn
  • www.hodulate
  • www.lucania
  • www.mkv
  • www.opoppks
  • www.sharefindcezh
  • www.uuzubfvpwtl
  • www.visumimag
  • www.xpadvocats
  • yasnyi
  • ysyfplzinm
  • zdnet
  • zenposmega
  • zimmassistant
  • 010awale
  • 0ibfkpjd8
  • 2020.c2box
  • 31hasan31
  • 3dsakevlc
  • 432rhlsf
  • aaronrif
  • acatisfine
  • ahkong
  • airsonic.nassantiago
  • ajimukti
  • alghazu
  • amargusdata
  • ambil.diamondff-freem
  • amsade
  • anbelna
  • appvn-baixar
  • april-giveaway108
  • arzodev
  • bandileshandu
  • barcomprep
  • bettyql96
  • biglove
  • bmizrfubji
  • bolm
  • bsoolo70
  • caiprotac
  • cctrf46e
  • cctvampang
  • cdmpar
  • cerenakkayanude
  • charco
  • cherenfa
  • chihiro-chang-patreon-pics.prodin96sai
  • claimitem-oldfreefire
  • claimm
  • cmm
  • coda55
  • codhashop-evnt-id-1
  • comet-rat
  • compuservpi
  • config.kistune
  • confusa
  • consnicas
  • continente
  • coucou.mmz06
  • cpanel.206kuotagratis
  • cpanel.2dafjsfhgwwr
  • cpanel.306wagrup
  • cpanel.53-online
  • cpanel.870-secured
  • cpanel.ambil-skin-gratisff
  • cpanel.amrz-accomanagerapppesetiasap
  • cpanel.amz-updatedetails194
  • cpanel.amz-updatedetails222
  • cpanel.amzn-signin-kgans23iugr
  • cpanel.amzn-signin-p0c0ngx117
  • cpanel.auth-verifypageamazon-aws
  • cpanel.authorityaccountamazonusa
  • cpanel.bkpseger.crtteross
  • cpanel.bookeepxxx
  • cpanel.bug-terbaru-codashop
  • cpanel.chatwhatsappgroups50
  • cpanel.claim-creat
  • cpanel.claimbundleoldff
  • cpanel.claimeventcodashop6
  • cpanel.claimfreefiree-eventgoklik
  • cpanel.click.fclaimevntznew
  • cpanel.cobra.eventfreefire05
  • cpanel.codashoppindonesia
  • cpanel.duniagames-free09
  • cpanel.duniagames-termurah
  • cpanel.event-berhadiah.domain-free2021
  • cpanel.event-garenashop
  • cpanel.event-gratis-ramadhan-2021
  • cpanel.event-ml-bb
  • cpanel.eventpubgmobilenewby
  • cpanel.events-com193
  • cpanel.ff-advancegarena9
  • cpanel.ffevent-gratisanclamy2021
  • cpanel.free.codashopfree-new2
  • cpanel.freefire-newevents
  • cpanel.freefiree-codashop-v1
  • cpanel.freeitem818
  • cpanel.freespin-eventfwp19
  • cpanel.fullnontongrupwa45
  • cpanel.groupnewbkp18
  • cpanel.join.groupwhtasttapp
  • cpanel.kulgar-gmff
  • cpanel.lucky-spin-terbaruu
  • cpanel.luckyspinfreefire-event21
  • cpanel.luckyspinfreefire-v2
  • cpanel.luckyspinn-vdgj
  • cpanel.mlbb.mlbbevetnvip2021
  • cpanel.new.kuotakomendi-sekolah2021new
  • cpanel.nontonvideohot
  • cpanel.online03careprofile
  • cpanel.ridwananakmonyet
  • cpanel.secure03-account
  • cpanel.secure78a-24siinfosepc
  • cpanel.server-09id
  • cpanel.simontok1
  • cpanel.support-asfasufh-secure-safsafasf
  • cpanel.ucshopa
  • cpanel.wagrub.eventyy01
  • cpanel.wanbling-mlbb073
  • cpcalendars.1la5nh-0004dh-4a
  • cpcalendars.45yghjmbndfgflogin4tfgc
  • cpcalendars.amz-rama036
  • cpcalendars.amz-updatedetails188
  • cpcalendars.amzn-de-signin-8712nv6b4nk1t21-174
  • cpcalendars.amzon-signin-8194s4mkv282
  • cpcalendars.chatwhatsappgroups32
  • cpcalendars.chatwhatsappinvit
  • cpcalendars.claim-free7b
  • cpcalendars.claimbluetrueid
  • cpcalendars.claimhadiahgratis-0111
  • cpcalendars.claimold-freefire4
  • cpcalendars.claimskinmobilelegendspp
  • cpcalendars.claimskinneweventgv
  • cpcalendars.claimspesial
  • cpcalendars.codaffeventtopup9
  • cpcalendars.codash-dmgratis
  • cpcalendars.codashop-diamond9v
  • cpcalendars.codashop-freefire-bug-2021
  • cpcalendars.codashop-topupgameff
  • cpcalendars.codashopbugfreeh
  • cpcalendars.event-garenaa221
  • cpcalendars.ffgarenaresmi2
  • cpcalendars.free-claims2
  • cpcalendars.free-fayr-sg
  • cpcalendars.fulldurasigrupwa49
  • cpcalendars.garena-event16
  • cpcalendars.grubbokep.videovirals2021
  • cpcalendars.grubwhatssappcimbrutt
  • cpcalendars.hostmyserver
  • cpcalendars.joiinwhatsapp9
  • cpcalendars.joinn-wabgrubdw
  • cpcalendars.kopral-jono2422
  • cpcalendars.lucyspin764
  • cpcalendars.nadbdsqm
  • cpcalendars.new-spincobra
  • cpcalendars.p.eventff2021new
  • cpcalendars.reditsc99-gg
  • cpcalendars.scgg.kinghost-53
  • cpcalendars.secure-mybecu
  • cpcalendars.shopeeid
  • cpcalendars.trinitynewport
  • cpcalendars.ttmmek
  • cpcalendars.vip-joinwhasap99
  • cpcalendars.whatsapid
  • cpcalendars.www-xnxx-bokep
  • cpcalendars.yunzjoxx
  • cpcontacts.112273
  • cpcontacts.242wagrup
  • cpcontacts.alltopupcodashop-ffml
  • cpcontacts.amzn-signin-8714mp45m3n136
  • cpcontacts.attackontitaforumzinfo
  • cpcontacts.bdjkfnrdgsd
  • cpcontacts.ch4sesupp0rtt3amred1rect
  • cpcontacts.chat-whatsapp8jhvztulp7ajofk9jua3jfly4
  • cpcontacts.chatvideocallnakal55
  • cpcontacts.chatwhatsappnakal65
  • cpcontacts.claim-hadiah-dari-kulgar-disini
  • cpcontacts.claimcodabugss
  • cpcontacts.claimepointpes-2021
  • cpcontacts.claimevent2
  • cpcontacts.claimhadiah.claim-myall
  • cpcontacts.claimhadiahff1
  • cpcontacts.claims.events-garena2021
  • cpcontacts.cod4shop-gar
  • cpcontacts.codashop-topupff92
  • cpcontacts.codashop25
  • cpcontacts.codashopfrefireid
  • cpcontacts.colmexs22
  • cpcontacts.connect21-verify
  • cpcontacts.ecrottkuy
  • cpcontacts.evebtcobra372
  • cpcontacts.event-freefire-id
  • cpcontacts.eventcobra-idg3tin
  • cpcontacts.facebook168
  • cpcontacts.fftrueevent0021
  • cpcontacts.freefire-idgarena
  • cpcontacts.freefireth-luckyspin
  • cpcontacts.fullnontongrupwa48
  • cpcontacts.garena-diamondeven
  • cpcontacts.garenaff.event-specialramadhan
  • cpcontacts.gossmotors
  • cpcontacts.gratis-luckycrate21
  • cpcontacts.grup-tante2021
  • cpcontacts.grupberbagi-video
  • cpcontacts.joingrupbokep-vvip
  • cpcontacts.lukyspin.infogame
  • cpcontacts.mmk2rsa
  • cpcontacts.notifications-6ew81a8v0w8999
  • cpcontacts.secure-userverify
  • cpcontacts.secure7val-joasownms961cx
  • cpcontacts.securecoonectp-b
  • cpcontacts.spin-freefireindonesia
  • cpcontacts.topevent
  • cpcontacts.xnxx-joingrubbokep
  • crm-bethefirst
  • culdilo
  • cuyowzon
  • dapictwam
  • davermenator
  • ddesidj
  • dekken
  • depdfmanualow8
  • devopsn1
  • devx
  • diprixserver
  • docker-mods.kistune
  • docker2021
  • docomoitko
  • duckdns312
  • dvrvpn
  • dwork
  • efixledrive
  • efuwrwufwr
  • eljardindeldeso.prestaimport
  • elledge
  • elysta
  • emanuelinbest
  • enmhfajizq
  • erbgtzfadm
  • esp-home
  • esre
  • etscarer
  • eventfreefire05
  • eventgratis34
  • exseg
  • faceb00k.fb-security-checkpoint
  • fasezonxjf
  • feedbv1ll
  • fezair
  • fgduu-skip
  • foxden
  • fpypxfghoq
  • gabung.bokep-join-2021
  • garath
  • gffjhgkhgfjhm
  • gfjhg
  • gfulunen
  • ghostbusters
  • giggalex
  • glanabam
  • gmsettings1
  • godfathercreations
  • gokuowmi
  • group.mabarnotnot
  • grubwhatsapsange
  • grubwhatsup-youtuber
  • grupbkp11
  • grupnotnot38
  • grupwaytbr-new
  • guacamole.prestaimport
  • gvmcerbgqz
  • ha89
  • hackerab
  • haji-nas
  • haysfork
  • hd20
  • hgvbilfmfd
  • hmsv
  • hommer
  • hopewxsieenc
  • hot18-s2021
  • hpb-buero
  • hugh-miller-libro
  • huljxldesk
  • huzz
  • iadxsqhypd
  • ifav
  • igbulwokoid
  • iiefmf
  • ikckzr
  • incognito1
  • infofasett
  • init.karlla
  • inw1
  • irkjahwci
  • ivankovo
  • ivix
  • jabl
  • jatofe
  • jeez
  • jeffco
  • jh26
  • jherranzp
  • jnet-edi-home
  • jofimifb
  • joingrupbokp-xyz
  • jpd1614
  • jqkmwflgeo
  • jsan
  • julian2
  • jwhbvxav
  • jxlxpzidyw
  • kallichooo
  • kathrine
  • keremsanti
  • kh40ssmp
  • khazgere
  • khoangohome
  • kings145
  • km-pro2
  • knjige
  • kqvv
  • kwkw.claimitemggefree
  • lbmc
  • leecellc1
  • legends4ever
  • lidarr.shadowsbox
  • locallhost
  • luckyfreegarena6
  • m-plexsorozatok-vendeg
  • m5mf3k
  • machack
  • mackcelru
  • madomobox
  • mafovi
  • mail.acct-verify21-web1
  • mail.activation53wells
  • mail.aggiorna-face-book
  • mail.amazon-signin-871k4mis1231-167
  • mail.ambilldiamondgratis
  • mail.amz-updatedetails206
  • mail.amz-updatedetails305
  • mail.amzsupport-ticketdashboard3
  • mail.amztot
  • mail.appstore-smartmusic
  • mail.battleroyalfree
  • mail.bifp3rmulihan
  • mail.bug-eventff
  • mail.chat-whatsapp-bucinan-gamers
  • mail.claim-item-old-garena
  • mail.claim-spins72
  • mail.claimcobra-ffevent
  • mail.cobraa.claimmcobraanext
  • mail.coda-sghop1
  • mail.codashopbugfree0028
  • mail.codasop-free-2021
  • mail.diamindfreefire28
  • mail.durasifullgrupwa35
  • mail.evengratisfdw
  • mail.eventclaimfreefirebgid
  • mail.eventgarena-id
  • mail.eventgarenaff4045
  • mail.eventgratisf3
  • mail.free-21sgapi
  • mail.fullnontongrupwa37
  • mail.gabung4-wa
  • mail.getporm
  • mail.grendoworld
  • mail.gruppwabokepp
  • mail.higgsdominoevent2
  • mail.join1.grupwanew
  • mail.join56wa
  • mail.kasihhadiah
  • mail.lulukmancung
  • mail.melpubg
  • mail.mlbbrewardakin
  • mail.pbzepettoevent
  • mail.pubgspinn
  • mail.ramadhancodashop
  • mail.secur5jverify
  • mail.securefcnch0
  • mail.server-redirect4
  • mail.sexy-grup-wanew
  • mail.sh-bambanadwawdoad
  • mail.spingratisgarena
  • mail.teszipagesm
  • mail.tncentglobal7
  • mail.vip22-choda
  • mail.wa-join55
  • mako1
  • mangement
  • masuk.bokeppvirall
  • mellowkidd1001
  • memeqwe
  • menelao
  • mestrededicado
  • mfanarh2005
  • mjgojkcpaf
  • mjobwgqwfv
  • mrfreenet01
  • mtnluyah4
  • mufiva
  • mycoop
  • mzxbtoyqex
  • nas.devmate
  • nasser303
  • nazmwxorqa
  • ncanethe
  • ni55
  • nileo
  • njrat6597
  • nscs
  • nuluwv
  • nyfoysnirt
  • ocdyimgufe
  • ochentayunorem
  • ok-server
  • oklm
  • ombi-staal
  • omvhomeserver
  • ondaback
  • onemu
  • onevfwgblu
  • opf0k
  • opketes
  • oyhymomzup
  • padayqkltr
  • pangure
  • parauara
  • parisien-backup
  • parpali
  • parrotrd
  • payfingand
  • paytravor
  • perre
  • pgc
  • pigozxswpa
  • piwigo.torscloud
  • pkjhcwzmeh
  • play1317
  • play3022
  • pnquxkjlvq
  • pomegranates
  • ppm5060
  • proto
  • proxy7
  • pseudo1
  • purpleblurpl.duckdns.orgpurpleblurpl
  • qakuhktpnx
  • qbittorrent.sabotad
  • rbvpn
  • renovacionesofi
  • rkss
  • rock-dabo
  • rot145
  • rpiomv5
  • ryodrglmxh
  • safameoficina
  • sago
  • sdhhjodrfy
  • sdsz
  • sebestbloom
  • secure03b-recover-account
  • semhass
  • senyuminas
  • serviceccount-limitedinfo.aertmbnegh
  • sg-2
  • sgproxy-do3
  • shintv
  • solvedals
  • sotuper
  • sphaqqci
  • spud693
  • squirrelnet1337
  • stagingsne
  • stamped.plwebtest1
  • statemc
  • stevounraidombi.stevounraidombi
  • still
  • strapi.sondt-cloud
  • sub-fr
  • sumisi
  • svilcure
  • swiercze
  • szqmegeeoe
  • tatnmbrt
  • tb8852.duckdns.org
  • tc-nas
  • tdkfojrksd
  • tebu
  • terrorfontein
  • testmd
  • tgsb
  • thenazisallnet
  • thunderkid
  • tiomisbi
  • tkop
  • tps01
  • tr36
  • triophoto
  • tripinas
  • trusinil
  • tvn
  • tydreon
  • uewcmwqilr
  • umonac
  • under-the-mountain
  • unimke
  • updated-event-mobile-legends
  • upnorth
  • us99
  • usbenso
  • vandenhove
  • vcxv52d
  • vefgcgopal
  • ventanas
  • verliebt
  • vervideo102
  • video.sun-nas
  • vlfanxdgpj
  • vltyllaqtw
  • vscode.duix
  • vsdfzh
  • vvalii2j
  • webdisk.1wsrfhy52w3
  • webdisk.290kuotagratis
  • webdisk.2informaidfyhf
  • webdisk.2wskgw3elet
  • webdisk.amazon-signin-871r4b01231-163
  • webdisk.amazon-signin-871sabtu21-160
  • webdisk.amazon-signin-871sabtu21-165
  • webdisk.amz-derry003
  • webdisk.amzn-de-signin-8712nv6b4nk1t21-171
  • webdisk.amzn-fr-signin-871senen21-151
  • webdisk.amznsupportcenter-dashboard1
  • webdisk.amzomn24urc
  • webdisk.authverifyidamz
  • webdisk.bonus.terbaik.pubgharam
  • webdisk.chase-online-user0bc
  • webdisk.chatwhatsappgroups02
  • webdisk.chatwhatsappgroups82
  • webdisk.claem-ggfree-garena
  • webdisk.claimeventgarena33
  • webdisk.claimspinnew-ff-gratisss-reall
  • webdisk.codashop-newbnx
  • webdisk.codashpindo
  • webdisk.customersnewservicessecure04a
  • webdisk.diamondff647hr
  • webdisk.duniagames98
  • webdisk.durasiindohot
  • webdisk.epepfreeevent0
  • webdisk.event-freefire-indonesia2021
  • webdisk.event-frostdaimondff
  • webdisk.event.crateold1
  • webdisk.eventbuyer.crateevent-garena0
  • webdisk.eventnewterbaru14
  • webdisk.evntff.freefire-2021-ramadahan
  • webdisk.ff-spin1
  • webdisk.fftrueid
  • webdisk.freefirexyz-com
  • webdisk.group-tantebasah
  • webdisk.item-spesial-gg2021
  • webdisk.iwannihboos
  • webdisk.jaiaikk-fash.free-joinkuy
  • webdisk.joinchatwhatsapp18
  • webdisk.joingrupsex888
  • webdisk.joinwacantik99
  • webdisk.loot-crate
  • webdisk.mlbbinfoskin2021new
  • webdisk.mystery-ff-claim
  • webdisk.new-eventfreefireramadhan91
  • webdisk.prepaid-processing01
  • webdisk.secure-04-netflix
  • webdisk.secure9cverify
  • webdisk.secured-connect28
  • webdisk.sh-oneclick
  • webdisk.sowetogranulatedsugars
  • webmail.333wagrup
  • webmail.amazon-signin-871jum11-151
  • webmail.amazon-signin-871sabtu21-166
  • webmail.amzn-signin-8714mp45m3n134
  • webmail.amzon-signin-8194s1ns-mkvb19
  • webmail.balmcrt
  • webmail.blabla1
  • webmail.claim-event43
  • webmail.claim-spin268
  • webmail.coda-shop-new
  • webmail.codfashop2021
  • webmail.createold79
  • webmail.diamondfreevent-899
  • webmail.dunia-game-freefire86
  • webmail.durasifullgrupwa23
  • webmail.event-freefire-id
  • webmail.event-spin121
  • webmail.eventtspinnw
  • webmail.ff-claim-event-garena
  • webmail.ff-id8-com
  • webmail.ffevent-claims
  • webmail.free-eventramadhan
  • webmail.freefireeventdmgratis2021
  • webmail.freespin-221
  • webmail.fulldurasigrupwa56
  • webmail.garenaxyt
  • webmail.group-tantenakal
  • webmail.grub-gq-7273-com
  • webmail.kiboyy-garena
  • webmail.lesstogether
  • webmail.lootcrate668
  • webmail.new-coda-shopp
  • webmail.newevents
  • webmail.notnot-joingruplknk
  • webmail.parah.dibawahumur
  • webmail.paypal-secure02
  • webmail.pembelokiran-fb
  • webmail.required-manageyouracccount
  • webmail.skinskin
  • webmail.spincrateff
  • webmail.support-verify-unauthorizedaccess
  • webmail.tiktokhadiahfree
  • webmail.vvip7799.newscript
  • webmail.waavralgrub
  • wgsqglqhsh
  • whoa
  • wordpressupdate
  • workstationcfdjpzca
  • worltrotters
  • wsen
  • www.dylanpros2021.newgo-17
  • www.eventnew.spinfftergg2022
  • www.new.luuckyspinvviip2021
  • www.serviceaccount-lockedinfods.cjdhkedgdk
  • www.spinn.event-ff023
  • xbge
  • xbpj
  • xbqt
  • xcan
  • xcly
  • xdld
  • xdmb
  • xech
  • xenjamo
  • xeom
  • xfiv
  • xfkc
  • xgkn
  • xhad
  • xhji
  • xhso
  • xibg
  • xjnj78
  • xjxh
  • xxvolu26
  • yhfaix
  • yoboyrsa
  • yote
  • you-video-japan-dngnym
  • yvamxwrgaxwwnrlnfgubrxnfpipdbpfvulczgnhg
  • ywim
  • za4
  • zackbackupnextcloud
  • zalupbde
  • zalupbkq
  • zasa
  • zata
  • ze9yrt22b3cejye48unk.073
  • zedico
  • zewsdadu
  • zhwyndey
  • zjebaqgsjs
  • zruafqgtwi
  • zubi
  • 3h7v9d0t-2a6w7e-h8f3s5
  • 5efgwgw
  • 84f
  • abigel
  • acutesailboat
  • adminer.stl1
  • ajy0714
  • aklejavagen
  • amigoti
  • antlerhome
  • appleid-cloud2-update-accountinfo
  • aragorn007
  • askrigg
  • astrolabius
  • asturiasha
  • atarito
  • banhbaohome
  • bayton
  • berlingo2
  • biggestcloud
  • bingpowradarr
  • bitlo
  • blakelybunch
  • blakeserver
  • boscalent
  • brown4
  • buxtehude
  • caffio
  • capouest03
  • carlitopunk
  • carmita-casa
  • casakoster
  • cbenson
  • cffz
  • chaosrequester
  • chibillibilli
  • cho0p
  • cipri90
  • cleanliest
  • confid
  • corysbw
  • cpanel.aervui
  • cpanel.huaooao
  • cpanel.mia011
  • cpanel.rwnsm
  • cpanel.wtayus
  • cpcalendars.wellsconfigurtion
  • cshserver
  • cyborc
  • d94pam
  • dacha-olla
  • damianshomeassistant
  • davewatson
  • davssistent
  • dbxjbabwsb
  • dcl
  • deborahwyp
  • depart-financeira7
  • dev-test
  • devkinhjs
  • diegocfranco
  • dkspex
  • dominoduck2055
  • drie
  • eken
  • espiha
  • etherplex
  • eu-loraserv
  • facultatively
  • fantasticfox
  • fbschep
  • federicoghin
  • fraschi
  • gaetanomarotta
  • galessoa
  • gethundsmit
  • godaddy-workspace
  • gojunu
  • gregdom
  • griphus
  • gsc-cloud
  • gxqmjcfhgk
  • gzckhiefze
  • h-house
  • hatipovic
  • hedstrom
  • hemharantis
  • hemphouse
  • home-microbe
  • hometoto
  • hrnaegeli
  • iinjrcwdjp
  • inve1
  • jeepi
  • jrmckins
  • kiwiis-home-assistant
  • knibbetulen
  • ktsnoip
  • lamassinie
  • laughingzoo
  • lekaharkko
  • lg188
  • lightning-srv
  • littlevenice
  • lnfsdkqemj
  • logginnmicr0soft0nlinee
  • lv11
  • mail.yahhoon
  • makkie2002
  • mdcrespo
  • mediapic
  • menorkrl
  • mi-a2-custom-firmware.stubmo41han
  • mikehouse
  • millshouse
  • mkais
  • mkbshome
  • mnygbglosioao
  • monitoes17
  • mta-sts.blackmango
  • mta-sts.dukeszone
  • mta-sts.evanstest
  • mta-sts.farfarawaykingdom
  • mta-sts.hass-elleffe
  • mta-sts.hassflaymen
  • mta-sts.heneassistant
  • mta-sts.homeautodo
  • mta-sts.invadedspace
  • mta-sts.johnnycapslock
  • mta-sts.mta-sts.aloowak
  • mta-sts.mta-sts.brownsgreen
  • mta-sts.mta-sts.casapiadena
  • mta-sts.mta-sts.cho0p
  • mta-sts.mta-sts.claymountain
  • mta-sts.mta-sts.cododajnia
  • mta-sts.mta-sts.dcopenhab
  • mta-sts.mta-sts.domusview
  • mta-sts.mta-sts.kupsconnect
  • mta-sts.mta-sts.lospaul
  • mta-sts.mta-sts.myframboise
  • mta-sts.mta-sts.netizenoverflow
  • mta-sts.mta-sts.rumseyhouse
  • mta-sts.mta-sts.thesenate
  • mta-sts.mta-sts.thingmonster
  • mta-sts.mta-sts.woodandwater
  • mta-sts.mta-sts.zooty
  • mta-sts.myncloud
  • mta-sts.nunoejoana
  • mta-sts.oldhamuk
  • mta-sts.papicfamily
  • mta-sts.pat-home
  • mta-sts.printsnmoore
  • mta-sts.rfpred
  • mta-sts.vitomar
  • mta-sts.waden
  • mta-sts.wsn
  • mta-sts.www.flodus
  • mta-sts.www.sebaix
  • mta-sts.xabiier
  • mynameisfred
  • nanase
  • nanndiw
  • nassan
  • netville
  • newtroll
  • nextcloudhilde
  • nibbbadcpa
  • nickdns106
  • nickdns58
  • nihaomike
  • nunohorta
  • nymag
  • nytrends
  • ohjqqozsty
  • oidafett2
  • ojcpxptcuj
  • okvxizukts
  • omegawow
  • oqodulwhze
  • orszulakeum
  • p314
  • p3tter73
  • paulus-home
  • pennetestre
  • perryhomestead
  • phwebdef
  • pierv
  • pis-depediloilo
  • port53896
  • portainer.ilirium-dev
  • ports
  • pui
  • r0v
  • r312645
  • raabovi
  • rasihome
  • ravenloft-ha
  • redir-account-support-5
  • redlights
  • reneehome
  • retardative
  • rickbaneaws
  • rohaimont
  • rowiehouse
  • rubencorrea
  • saarplex
  • sagoma-hass
  • samsung-gear-s2-firmware.covat35self
  • santa-empresa27
  • schalcomche
  • seagate-theatre-firmware.aben81ca
  • secure-refund-amazonservice
  • serkansa
  • shadownbr
  • shakra
  • siamesetrading
  • sikiknecmi
  • slartibartfast-vtrs
  • solsticenas
  • sponginblast
  • stabilskygge
  • stfha
  • swennen
  • tacomaha
  • telecharger-crack-key-code-d-activation-pour-4ukey-for-android.ruli51prot
  • terpgevi
  • thebhatfamily
  • theddoghome
  • thedochssonarr
  • thody-home
  • topup-gratis-freefire99
  • transmission.marouby
  • tungnguyen95
  • tyndalos
  • unopinionated
  • unraidfritzy
  • verzeppqqv
  • vikland
  • vpscl
  • wahlstrom
  • ware69
  • webdisk.godamner
  • webdisk.kaloeje
  • webdisk.pharmacyq
  • webdisk.qyedh
  • webmail.carderui
  • webmail.hksnj
  • wesolydomek
  • woodhollow
  • wsen1
  • www.gunscreaed
  • www.login-micrrsuftonline-com09j3o9djio3
  • www.pfblog
  • www.zkhack
  • xged
  • xiashu
  • xiktpzybcz
  • yiamhyatir
  • zooty
  • 13zxczxc
  • 200bar
  • aaronhx7
  • alertverifies
  • alleyfrog
  • apps.nirox
  • bakaubook
  • calkafor
  • chat-whatsapp-invitez
  • conleyjoann
  • cpanel.chat-whatsapp-grub
  • cpanel.codashop66
  • cpanel.grub-join.whatshapgrub18
  • cpanel.info-updateing
  • cpanel.joingrubmabar-free
  • cpanel.joingrubwadn
  • cpanel.server-08isup
  • cpcalendars.amz-updatedetails130
  • cpcalendars.amz-updatedetails137
  • cpcalendars.diamond-efef-grts
  • cpcalendars.joinmygrub186
  • cpcalendars.newbalm
  • cpcontacts.amz-updatedetails125
  • cpcontacts.dmffgara
  • cpcontacts.duniagames-2021
  • cpcontacts.event-freefireggneww
  • cpcontacts.uhahuahcfa
  • cuti28
  • darnellclarice
  • dgdwzuyjp
  • diegoparra
  • domoticaolivares
  • e3532
  • elor
  • er4qpsrny
  • file3
  • frdqqqddpd
  • freediamondml03
  • fzencasavu
  • garena2021
  • hackztor
  • ibann
  • jayfocus1
  • jimvanm
  • john-doe
  • kennytv
  • kickin
  • kidjah
  • kscsvr-0
  • larrykandi
  • legovishte
  • lemcyplex
  • lidarr.nugsolot
  • mail.bnaeaiudikaopauu
  • mail.coda-shopgratis9
  • mail.diamond-grtid-grena
  • mail.gabung132
  • mavalladolid
  • meoruccobb
  • mrhermoso
  • mta-sts.mta-sts.mta-sts.most
  • mta-sts.mta-sts.mta-sts.prupp
  • murtaghcaetlin
  • mypasswd
  • mysql.jgrutzma
  • nextcloudproject
  • nonggun
  • obdqerresx
  • oidhocjrce
  • onlinefilmezpt
  • oomejyqrfh
  • play6501
  • puigverd
  • pyramid
  • q0053
  • qjuskufjum
  • rbpmcs
  • rgaknil
  • rufodam
  • rvs4jap9ie
  • rxpdbqooqe
  • secure05helpchaseme.help-chasecustomer
  • servid2e
  • sharonbe2lmaria775i1
  • soportetopay
  • techoragonsingapore1
  • timselma
  • tsguuuhuzr
  • uymuwhrsbq
  • vgsfffssre
  • viperlegend
  • vpnadmin.mac-cloud
  • webdisk.chat-whtssalxygr
  • webdisk.diisepjanda
  • webdisk.grupwafullnonton6
  • webdisk.login-onelibnadssid839120
  • webdisk.skinskinml
  • webdisk.wahyukadeogruops
  • webdisk.whatsapp533
  • webmail.bokep-newwjib
  • webmail.bokep-sma
  • webmail.chase039secure
  • webmail.codashop-ff50
  • webmail.deskapiparpal
  • webmail.event-spingarena9
  • webmail.grupwasange87
  • webmail.jhonspubg
  • webmail.scartitanclaimnew
  • www.fedorhome
  • wzezofxcbd
  • xdis
  • xealamif
  • xifan
  • xubwgovvte
  • ywkiaiufmm
  • 0utc45t
  • 11635
  • 17flo
  • bakardi
  • banjohome
  • braide
  • byrneout
  • calmbrewergit
  • cinematicketsonline
  • codashopff
  • cpanel.invasded
  • dehaas
  • delta-tech
  • denenelercee
  • dewitthome
  • doilaavothong346
  • dragoneers
  • evertet
  • evolvingsite
  • germundsbo
  • giampirm
  • honore
  • jaindl
  • jami3
  • jelmervandam
  • jlahass
  • joaokmediaha
  • joslinmkha
  • jouberthuis
  • kakha
  • kiaoraestates
  • ks1g01
  • libslsicab
  • localical
  • magome
  • mail.fdyjked
  • mansavcloud
  • matthewauld
  • mc-uhlig-it
  • megabolielmej
  • mta-sts.app.demetrio
  • mta-sts.debesis
  • mta-sts.mta-sts.braleyfamily
  • mta-sts.mta-sts.itauconta5
  • mta-sts.mta-sts.iz0fwk
  • mta-sts.mta-sts.joaofelipes
  • mta-sts.mta-sts.nd88
  • mta-sts.mta-sts.radiosimpatia
  • mta-sts.mta-sts.raznet
  • mta-sts.myopenwrt
  • mta-sts.sonarr.kjames
  • mta-sts.thebaconboss
  • mta-sts.waatthefred
  • mta-sts.webdisk.gift-skin
  • mycastleho
  • ohad2705
  • plansmart
  • pottsy
  • pourghadiricloud
  • realrollers
  • rivierarabbit
  • secure07-verify-chase-info
  • shoes.pricerumors
  • siynfa-general-upgrade-1
  • squid
  • steambox
  • treehugger
  • trinec
  • tyjclark07
  • virtu
  • vluser
  • vpnstar
  • vyxer
  • web.mail-casa
  • webmail.bankt
  • webmail.conditi0ns
  • wongok
  • wpollard
  • wuillemin
  • www.service-apple-com
  • www.xsirius
  • xpenas01
  • xscvbnuyjhrfxcgvhb
  • xytest
  • zf8js3brtlkl9jsk
  • 1019
  • 10903
  • 10obm530
  • 192pz0rqq
  • 1wrct
  • 1z3
  • 27hilltop
  • 2iyf
  • 2pi
  • 31iwgh3lq
  • 36e92x2
  • 3f33jm
  • 3gpasrums
  • 3ula
  • 3y8bl7e42i4b9tf5h7sg.kda
  • 3zjlxnia
  • 404error
  • 41c
  • 4f69-ip2
  • 4vdrnsio
  • 4x42
  • 56z9h8
  • 62vk
  • 70w
  • 7e8004pz6
  • 855
  • 85q0b
  • 999
  • a1dvanced
  • a2fm3c
  • a3ry0
  • aamb3
  • aamdu
  • aarondz7
  • aaronfbe
  • aaronfmj
  • aaronj0d
  • aaronkl0
  • aaronkpm
  • aaronkvi
  • aaronlcg
  • aaronlpi
  • aaronm3u
  • aaronmwm
  • aaronot1
  • aaronqzm
  • aaronr2z
  • aaronrmc
  • aaronrrq
  • aaronrwj
  • aasa
  • ab56
  • abidgraz
  • ablisen
  • abmaso
  • abnjxvkt
  • abteefi
  • ac1dbath
  • acbipizti
  • acensa
  • acparphi
  • adanpa
  • adspecsaa
  • aegth
  • aetijfol
  • afaceneq
  • aferminj
  • aflite
  • agawon
  • aibateoj
  • aidojqas
  • aifz6h
  • aimware
  • airmata
  • airs
  • ajan37
  • ajefen
  • ajsswr
  • ajxu
  • alalit
  • alatfer
  • albino
  • aldilde
  • aleveqne
  • alex2epic
  • alhora
  • alinz
  • alpodi
  • altine
  • amabor
  • amaplrf
  • amecnalfe
  • amlo34qui
  • amlored
  • anagsui
  • anahaf
  • anamlad
  • anbbap
  • angel10c
  • apoc
  • apsc
  • aptalpi
  • aptget
  • arcecun
  • arglutar
  • arlene
  • armamun
  • armanje
  • armenhols
  • arprovac
  • arsiurul
  • arturas
  • arun89con
  • asdocga
  • asetex
  • ashcwj
  • ask10048
  • ask10079
  • ask10313
  • ask12242
  • ask13927
  • ask14213
  • ask14451
  • ask15122
  • ask17361
  • ask25508
  • ask3667
  • ask3918
  • ask4840
  • ask5175
  • ask5557
  • ask5572
  • ask6489
  • ask7473
  • ask8033
  • ask9230
  • ask9486
  • asluabte
  • asqettui
  • assigcu
  • asstowsis
  • astyles
  • asuncour
  • atdivi
  • athtagi
  • atinub
  • atynhm
  • aucam1
  • av8
  • avisan
  • avobog
  • axqwyh
  • aywmhb
  • backnigga
  • badohvaw
  • bailefu
  • bamuisyi
  • bar-miki
  • barnauno
  • barrie
  • barwrihan
  • baznii
  • bbnv3v
  • bbnvob
  • bbnw15
  • bbnwo2
  • bbny6r
  • bbnzmk
  • bbo1hi
  • bbo1lq
  • bbo3ux
  • bbo42h
  • bbo5m8
  • bbo6f5
  • bbo7uh
  • bbo89c
  • bbo8dk
  • bbo8ni
  • beefin
  • beleebpaw
  • benavxej
  • benmahou
  • berga12
  • bestoffer
  • betrayerddctv
  • beyazenci
  • bfgtygdfd
  • bgsw85
  • bgthza
  • bguio
  • bhfdjj
  • bibofor
  • bicgaled
  • binfortfa
  • bitwarden-familiabt
  • blazeowen
  • blenrh
  • blew
  • blisspdf
  • blog.bar.3ntity
  • blogqf22
  • blogwq75
  • bmo1
  • bocahe
  • bocahis
  • bondts
  • borvimang
  • boudbookscrubber
  • boylesg
  • bp
  • bpostvkdovrld
  • braham
  • brandao
  • brandop
  • brennoh
  • brfgreg
  • brfulp
  • briandev
  • brien
  • briscicom
  • britinter
  • bronakmag
  • bsoolfwh
  • bsooljww
  • bsoolm4a
  • bsoolm7f
  • bsoolm7k
  • bsoolmh7
  • bsoolmj2
  • bsoolp58
  • bsoolrip
  • bsoolsbx
  • bsoolu2h
  • bsoolu2z
  • bsoolu4o
  • bturiz
  • bturlmap5
  • bubbresi
  • bucisjutg
  • bucpk
  • buczo
  • bud1c
  • buintegin
  • bukjfx
  • bulcucom
  • buncabook
  • bunkery
  • burak2346
  • burnsige
  • buron
  • busbasand
  • buschi
  • buvudwexj
  • buyspasex
  • bvttpv
  • byalone
  • byfcrpqide
  • bygjus
  • byphio
  • byruiuo
  • bytunxjhx
  • c6mk7w
  • c8cm0y
  • cabgxl
  • caiterne
  • caldera
  • callisa
  • camobe
  • cannolat
  • capiver
  • cardari
  • cardinezz
  • cardmpw
  • carsiwa
  • cartsenri
  • casi1
  • casmz
  • catirab
  • caxujqep
  • cbuwvg
  • cctreskh
  • cctretjp
  • cctretqi
  • cctrev25
  • cctrevi6
  • cctrf1su
  • cctrf31t
  • cctrf371
  • cctrf3qf
  • cctrf64o
  • cctrf7pl
  • cd946
  • cd971
  • ceda
  • cehlqezh
  • ceisethe
  • cerenmau
  • cessseti
  • ch.zkpdf
  • chalvarea
  • charlioke
  • chashibil
  • chirilean
  • chootiti
  • chrimohr
  • ciacorri
  • ciaquiro
  • cihvmp
  • ciminscos
  • cine-priv
  • ciqytom
  • ciwafue
  • cjagkk
  • cjihmb
  • cklwtf
  • clacduso
  • clasinin
  • clasoreen
  • classarap
  • claudio
  • claw-back
  • clemutna
  • clermont
  • closicar
  • clouddvb
  • cloudmt2
  • clounu
  • coacare
  • coacoldia
  • coadicon
  • coafletom
  • cocapno
  • coceta
  • cockatoo
  • code-server.moritahass
  • codys
  • coluz6
  • comdina
  • comprerec
  • comtybe
  • concord
  • condime
  • conlemi
  • cons
  • continuum
  • cony-pony
  • coop
  • corkingso
  • corvus
  • cosuppla
  • cotdeza
  • cotijkoq
  • counpoca
  • cozamea
  • cpafunfe
  • cpanel.58b180ee
  • cpanel.chatwatshap186
  • cpanel.codashop-evnt9
  • cpanel.codashop-freefire-event-gratis2021
  • cpanel.crottot
  • cpanel.dewasa22
  • cpanel.eventcodashop-real
  • cpanel.evnts-garena10-com
  • cpanel.groupwa-tkdd
  • cpanel.joinwagrup-budi01gaming
  • cpanel.pubgtrick
  • cpcalendars.amz-updatedetails175
  • cpcalendars.appidsignaccountkil
  • cpcalendars.ceritawhatsaap8
  • cpcalendars.claim-giveaway12
  • cpcalendars.codashop72
  • cpcalendars.evnts-garena8-com
  • cpcalendars.garena-hadiahhh17
  • cpcalendars.grupbokepviral188
  • cpcalendars.grupwanotnot21
  • cpcalendars.online2secure
  • cpcalendars.skangntod
  • cpcalendars.spinitemff
  • cpcalendars.whatsapp718
  • cpcalendars.whatsapp727
  • cpcontacts.130kuotagratis
  • cpcontacts.180wagrup
  • cpcontacts.95kuotagratis
  • cpcontacts.ambilitemold
  • cpcontacts.bundle-claimff
  • cpcontacts.coda.claimcodahs
  • cpcontacts.diamond-gratis-kulgar-jb
  • cpcontacts.event-baru-2021-boskuh
  • cpcontacts.flxich-cash
  • cpcontacts.getfree.bundlefree
  • cpcontacts.join-janda-bahenol
  • cpcontacts.joingrupwhatsapp65
  • cpcontacts.luckkyyspinneww
  • cpcontacts.lucky-spingarenafreefire2021vip
  • cpcontacts.lukyspin
  • cpcontacts.mamahmudaxx
  • cpcontacts.qa1
  • cpcontacts.sec01chasupdatejp
  • cpcontacts.topup-codashopgame552
  • cpcontacts.turnamenff
  • cpcontacts.wahyukadeogruops
  • cpcontacts.whatsapp709
  • cpdfyd9b
  • cptaqbwh
  • cqgz27
  • cqwsd
  • cracked2
  • crafcerhy
  • crisinro
  • cristinan
  • critgeta
  • crkwhome
  • cru
  • cruminzu
  • csorboft
  • ctbypz
  • ctps
  • cu1vaqc67q0u8fm9nr5ff.svn
  • cubossmis
  • cumaegha
  • cusco
  • cutnow
  • cxckda
  • cxz
  • cycpewhin
  • cyvxghekzbx
  • d1ej1
  • d3icidal
  • d4aydream
  • d651ff
  • d6c
  • d8qs0
  • d9vq9l
  • dababjik
  • dadifa
  • dadmom
  • dafathew
  • daicelma
  • dairaika
  • danny
  • darkconnectrat
  • datuacul
  • daviseygo
  • dayberri
  • dayouhtil
  • db.dolibarr
  • dbhytdjn
  • dbiceb
  • ddesfq0
  • ddesg41
  • ddesglk
  • ddesh01
  • ddeshvl
  • ddesihj
  • ddesjcw
  • ddesknf
  • ddeskp7
  • ddesl0j
  • ddesl20
  • ddesmul
  • ddesn1d
  • ddeso7g
  • ddesoxj
  • ddesp72
  • ddespcm
  • ddesqa1
  • ddesrvc
  • ddesrwo
  • ddessho
  • ddesspb
  • ddestdn
  • ddestmq
  • ddesttr
  • decay
  • declyncre
  • dectikows
  • defmtsiru
  • deha87em
  • deherni
  • delajit
  • denseela
  • denveni
  • deodangte
  • derek04
  • detmu95ti
  • devsimulatedconversations
  • dewaha
  • dewixmuj
  • dewolxc
  • dgebuj
  • dgnas
  • dgqbzzad
  • dharinlau
  • dhfgkjsk
  • dhlyfa
  • diastarla
  • diavulle
  • diejunkma
  • diioa
  • dipcare
  • dispceme
  • dispfiwer
  • display
  • divi41wo
  • dkfxwztx.dcook
  • dlibaw4
  • dlibckn
  • dlibeqo
  • dlibfuw
  • dlibh60
  • dlibjnl
  • dlibjxz
  • dlibk4x
  • dlibk6k
  • dlibkl9
  • dliblhy
  • dlibpnh
  • dnqbzalmoq
  • dns108
  • dods
  • dogbilop
  • dolasal
  • dolonglot
  • donaldwza
  • donnamry
  • doretwhi
  • doubledummys
  • downconca
  • dpqnbv
  • dpqqdqivvv
  • drabtya71
  • drdoom
  • drekti
  • dresacin
  • drivbela
  • drivosex
  • drivterri
  • dspda
  • dtitec
  • ducbili
  • ductlicon
  • dudoruz
  • duoxwwgh
  • dupesy
  • dutaihlu
  • dwelomal
  • dwomtiba
  • dytegfe
  • eahokf
  • eajh52
  • eares78su
  • easyofjw
  • ebooks0gj
  • ebooks764
  • ebooks8by
  • ebooks8io
  • ebooks8k3
  • ebooksahw
  • ebooksb3y
  • ebooksc8c
  • ebooksd71
  • ebooksdw5
  • echobase
  • ecmartz-client2
  • economic
  • edatlas
  • edevak
  • edf5z4ef
  • edmetis
  • edpreteb
  • edtkzxqiw
  • edunec
  • eemos
  • eesujxub
  • eeyuniiv
  • efazel
  • efintin
  • efreappho
  • egeelgi
  • egmoldc
  • ekelso
  • elcaza
  • elchcraft
  • elit
  • elmyzg
  • elserver
  • embanta
  • emtelow
  • emthuzi
  • enabsup
  • enadiz
  • enat34ex
  • encqndz
  • enjoyou
  • enreifur
  • enrique
  • envio2018
  • eocanha
  • eomgyvrh
  • eotexgiq
  • eqquecus
  • erapen
  • erce21hor
  • erchinti
  • ercreenun
  • erenta
  • ergiakoo
  • erknivon
  • ermtrm
  • erprenol
  • erprepde
  • ersiri
  • erutoz
  • erzaco
  • escalri
  • esendi
  • esmalo
  • esriga
  • essay14
  • ethelam
  • etinat
  • etorar
  • eujunkaj
  • evansmith
  • evencobra-freefire2021
  • everin
  • evvbgvcbq
  • ewasne
  • ewebno
  • ewunye
  • exardau
  • exotlirlj
  • f2tamazon
  • fahl
  • failoti
  • fapeesrot
  • faqoolgah
  • farf
  • fbbox
  • fdcxyh
  • feedbusjh
  • feedbuugc
  • feedbuw4s
  • feedbuy82
  • feedbv2an
  • feedbv2wb
  • feeio
  • felpi
  • fenfvates
  • fern
  • feterpass
  • ffilmsyin
  • ffilmt013
  • ffilmt13u
  • ffilmt1z3
  • ffilmt2av
  • ffilmt2m0
  • ffilmt2p7
  • ffilmt5mz
  • ffilmt7f8
  • ffilmt9nu
  • ffilmt9wx
  • ffilmtayz
  • ffilmtbf6
  • ffilmtcpg
  • ffilmtcsn
  • ffqnip
  • ffvmtv
  • fghsfhh
  • fgndjmketyk
  • fgresfde
  • fibdto
  • fibtethe
  • ficanma
  • figital
  • fijivil
  • filmbuzo
  • fisheer
  • fixh8m
  • fizarsa
  • flicdiba
  • flynnos10
  • fmqsrel
  • fognarea
  • fokzlq
  • fotograf
  • foxed
  • fqisn76
  • fqytu
  • framovin
  • franconair
  • freelom1
  • fromicab
  • frostnova
  • fruhev10
  • fruhevgg
  • fruhexre
  • fruhf012
  • fruhf3ke
  • fruhf78g
  • fsasdbt
  • ftfgreg
  • fuk54iu18erh
  • fulbjosu
  • fur1a2
  • fybqiq
  • fyx
  • g5tu8kk
  • g6sd54fg
  • gafapppm
  • galyo
  • gammcv
  • ganteng
  • gbjzaokj
  • gcfexvcc
  • gdr
  • gedisdeo
  • gengikor
  • geolases
  • geosasdi
  • germina
  • getfll6c
  • getflm28
  • getflmyq
  • getfln8s
  • getflnl0
  • getflrko
  • getflsp5
  • getfltgf
  • getfluw7
  • getflvb8
  • getflwac
  • getflwhm
  • gfvdsgch
  • gfvdsgem
  • gfvdsife
  • gfvdsij6
  • gfvdsp5g
  • gfvdspcl
  • ggda
  • ggmouq
  • gherty
  • giabinhj
  • gifaswuh
  • gimosfid
  • gioiledaitrang0
  • gishass
  • gliese
  • glumanke
  • gmb356
  • gmedia
  • gnomnahi
  • godersdo
  • gogomix
  • gogon
  • goldenoutdoors
  • gonoir
  • goporspo
  • gqhmav
  • grsd1e
  • grsd5k
  • grtlrav
  • gsucnjgs
  • gts
  • gundee
  • gunz
  • gwbhxl
  • h2
  • habiton
  • hagbyvagen
  • haimuni
  • haiyen8
  • hanlacen
  • harlarar
  • harsh
  • hateme
  • hdmqut
  • hebetlen
  • heidicam
  • heluepla
  • hequqs
  • hexajwags
  • hgfgmgpe
  • hggfj
  • hgi
  • hhfkmp
  • hicezsig
  • hiiu
  • hijeemli
  • hisxnlyt
  • hjjmna
  • hjkirli
  • hjkiujb
  • hjkiuz9
  • hjkj3ww
  • hmxrjk
  • holafrem
  • hom3assistant
  • homali
  • home.ghisura.cozg
  • hoojc
  • hospote
  • houcipic
  • housemix
  • hpdragon
  • hqjada
  • hqtnjr
  • htpfvf
  • htry
  • htwlcsji
  • hufeshel
  • hundrece
  • hungdire
  • huntress
  • huraima
  • huyeh
  • hxobca
  • hxof390
  • hypervpn
  • i6850
  • iannunas
  • idavov
  • idelf
  • iedomboz
  • ieysj
  • igarres
  • igerber
  • igunny
  • igvyevqk
  • iipefjuh
  • imb1
  • imcore
  • imniraj
  • impots
  • inacblog
  • inanav
  • inblowov
  • indepma
  • inenap
  • inenban
  • inexup
  • info6142
  • info9911
  • infoo521
  • inidia
  • ininsi
  • initgen
  • inlutqui
  • inomfir
  • inrese
  • inrocha
  • insinso
  • intanno
  • iobaxkab
  • iodine
  • ip4012
  • ipbqyb
  • ipliki
  • ipmitde
  • ippetmo
  • isatim
  • isemlos
  • itaiquara17
  • itencu
  • itfezon
  • ithavi
  • ithdicer
  • itihca
  • itinta
  • itsourme
  • ittarea
  • itwinve
  • iztema
  • j0088
  • j1il1r
  • j2hnet
  • j427
  • jacmoca
  • jaladop
  • jannage
  • janst
  • jaramultimedia
  • jarinhaf
  • jase2
  • jausilec
  • javaweb
  • jcapaccl
  • jdivgj
  • jebiti
  • jegnlb
  • jfjnbp
  • jfogerty
  • jign
  • jilm80
  • jilmek
  • jiln50
  • jimtahler
  • jolrexz
  • jomdo
  • jongcobi
  • jorsize
  • jrsbar
  • juniordd
  • juruuxho
  • jutngq
  • jzxufd
  • kakourwo
  • kalrito
  • kandm
  • kardime
  • kcrdpphugt
  • kdqzmy
  • kekkoe
  • kekuacra
  • kelam323
  • kexaibfe
  • kgfizs
  • kiamonli
  • kieuanh4
  • killatos
  • killatpg
  • killavmw
  • killaxi6
  • killaz3k
  • killb3vj
  • killb5w9
  • killb5wv
  • killb7h5
  • kimmeria
  • kinggoat
  • kixamrav
  • kkihfzgw
  • kkihfzoc
  • kkihfzqo
  • kkihg0yt
  • kkihg2ie
  • kkihg2tz
  • kkihg4er
  • kkihg4jx
  • kkihg5zc
  • kkihg8bu
  • kkihg93o
  • kkihgah0
  • kkihgbof
  • kkihgc8z
  • kkihgdfm
  • kkihgdmm
  • kkihgds2
  • kkitc-phpmyadmin
  • klerlg1
  • klinedos
  • knihz1
  • kojabto
  • kokh
  • kosgalu
  • krag2obp
  • krbisoj
  • kruwedi
  • krysfjjv
  • ksicioio
  • kuheadme
  • kulomil
  • kutsu
  • kwaxijbf
  • kwyzelkf
  • kzod40
  • l7hf2
  • lafemome
  • lamington
  • lamrite
  • lascefi
  • lasdeli
  • lasmethe
  • lasx2vu
  • lasx406
  • lasx4ji
  • lasx6rz
  • lasx6t1
  • lasxa89
  • lasxcbe
  • lasxd4c
  • lasxd84
  • lasxe38
  • lecompa
  • lednogora
  • leitumi
  • lemorep
  • leodolca
  • lesbesi
  • lessrala
  • leysoata
  • lfosvm
  • lgsxar
  • libreaw
  • librejb
  • lieresi
  • lijeisvu
  • likemy
  • linrare
  • lipenlo
  • lireten
  • liroci
  • lisa5i
  • lisayb50
  • lisue
  • lit50
  • lit6w
  • liwilra
  • ljnrqqxm
  • llosqhb
  • llossmv
  • llosxh2
  • lloszka
  • llot0nf
  • llot1rq
  • llovelnu
  • lobakian
  • login-microsoftonline-com-voice7368349
  • loheld44ac
  • lominpho
  • lopstrne
  • lovalca
  • loveters
  • lowlosi
  • loynegas
  • lubicom
  • lucenec
  • lucid
  • lukita13
  • luqsqo
  • luvepar
  • lwn
  • lxyatxga
  • lypdenec
  • lzhiwl
  • m1001
  • m34
  • m345b
  • m55
  • m666m
  • macaisnu
  • maibecon
  • maid
  • mail.181wagrup
  • mail.chat-whatsaapinvite
  • mail.claim-item-ffnew
  • mail.codashop-neww-ff
  • mail.colmexs31
  • mail.diamond-gratis-kulgar-jb
  • mail.event-freeggnew
  • mail.eventsspingarenafreefirre
  • mail.facebook95
  • mail.fullnontongrupwa34
  • mail.garena.freeitemm2021
  • mail.gratis1spinff
  • mail.grupwafullnonton63
  • mail.hadiah-evnt-ff
  • mail.osuboard
  • mail.videodewasaxm
  • mail.whatsapp777
  • mail.xclaim-eventnww
  • mail.xxnx-vidios
  • mailessa
  • maimabho
  • maisonpebaril
  • manload
  • manpocul
  • manrat
  • mantticu
  • maqneni
  • mariandm
  • marisol
  • marocfov
  • marotip
  • martyzzz
  • masekotcp1
  • maseri
  • matpaver
  • maxium
  • maybeqpl
  • mdsksoj
  • meatirea
  • mebdeven
  • mededick
  • mediamanager
  • meetapb
  • meetcwp
  • meninand
  • merravab
  • meszuter
  • mewalria
  • mfumufuw
  • mgbmc
  • mhxtcr
  • midelmo
  • mielno
  • mime76ga
  • mimobi
  • mine123
  • minecraft.i7qhqg
  • mioutte
  • miphifor
  • mitagab
  • mlhhack
  • moc
  • molido
  • mongrel
  • monmari
  • montysb
  • moyrase
  • mpese27
  • mpgdie
  • mre
  • mrgrey
  • mta-sts.bkcloud
  • mta-sts.fredarro
  • mta-sts.mta-sts.mta-sts.lunaplex
  • mta-sts.mta-sts.mta-sts.medea
  • mta-sts.mta-sts.mta-sts.xabiier
  • mta-sts.mta-sts.muximux.unraid74
  • mta-sts.sorla
  • mta-sts.sskim
  • mta-sts.teslar
  • mta-sts.vlabtek
  • mtahtc
  • muc
  • mugarteshome
  • muhapb
  • mupothur
  • muriel
  • muypio
  • mx001
  • my024j
  • my366t
  • my715h
  • mybp
  • mycloud7
  • n0z
  • nabodher
  • nadunfoy
  • nakaicxe
  • nalonyif
  • nancyyqa
  • nanodn
  • nasnidis
  • nbss
  • neboefsi
  • nekwih
  • nelawgis
  • nenrouter
  • nepfdg
  • nerecin
  • nerfihop
  • nerved
  • neupinro
  • neva
  • newman
  • newslude
  • ngdig
  • ngzsry
  • nh0
  • nibota
  • nikmos
  • nisegi
  • nislili
  • njozlw
  • nly
  • nmrjnt
  • nmysalto
  • nnnial
  • nocalen
  • nokepwkv
  • norohai
  • norucer
  • norvadu
  • notupopp
  • nqhele
  • nqwuci
  • nudges
  • numcoso
  • nuotop
  • nup
  • nvesalso
  • o0pu1t
  • o4pu9t
  • o5ey3h
  • o5pv9
  • o9lt0
  • oadij
  • obindia
  • ocabvin
  • ocaphin
  • ockyle
  • oeheqjis
  • oewihdof
  • ofanin
  • ofhode
  • ofics
  • ofunat
  • ogrothou
  • ogxjqzdw
  • ojee
  • ok-73679
  • okfa
  • oktharis
  • ollan
  • olpede
  • oncapsi
  • ondexvd
  • onjafer
  • onlien-alerts
  • opensim
  • opezrh
  • opsorzi
  • opuneb
  • oqpi
  • orlepma
  • orxsx41
  • orzel
  • osal80ev
  • osjoro
  • oube
  • overli
  • ovjcjb
  • ovmoper
  • oxmmvb
  • ozooxx
  • p-w-dom
  • p08
  • p2yk3p
  • palegli
  • palice
  • partizan
  • pasqualone
  • pcjnpr
  • pdonmn
  • perazacomplabo
  • perreta

Current DNS Records

A AAAA MX TXT NS SOA

167.99.141.59

n/a n/a n/a n/a n/a

Want useful, structured WHOIS and DNS data like this? Check out SecurityTrails

Raw Whois Results for 167.99.141.59

#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/resources/registry/whois/tou/
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/registry/whois/inaccuracy_reporting/
#
# Copyright 1997-2021, American Registry for Internet Numbers, Ltd.
#


NetRange:       167.99.0.0 - 167.99.255.255
CIDR:           167.99.0.0/16
NetName:        DIGITALOCEAN-167-99-0-0
NetHandle:      NET-167-99-0-0-1
Parent:         NET167 (NET-167-0-0-0-0)
NetType:        Direct Allocation
OriginAS:       AS14061
Organization:   DigitalOcean, LLC (DO-13)
RegDate:        2017-11-10
Updated:        2020-04-03
Comment:        Routing and Peering Policy can be found at https://www.as14061.net
Comment:        
Comment:        Please submit abuse reports at https://www.digitalocean.com/company/contact/#abuse
Ref:            https://rdap.arin.net/registry/ip/167.99.0.0



OrgName:        DigitalOcean, LLC
OrgId:          DO-13
Address:        101 Ave of the Americas
Address:        10th Floor
City:           New York
StateProv:      NY
PostalCode:     10013
Country:        US
RegDate:        2012-05-14
Updated:        2021-05-03
Comment:        http://www.digitalocean.com
Comment:        Simple Cloud Hosting
Ref:            https://rdap.arin.net/registry/entity/DO-13


OrgAbuseHandle: ABUSE5232-ARIN
OrgAbuseName:   Abuse, DigitalOcean 
OrgAbusePhone:  +1-347-875-6044 
OrgAbuseEmail:  [email protected]
OrgAbuseRef:    https://rdap.arin.net/registry/entity/ABUSE5232-ARIN

OrgNOCHandle: NOC32014-ARIN
OrgNOCName:   Network Operations Center
OrgNOCPhone:  +1-347-875-6044 
OrgNOCEmail:  [email protected]
OrgNOCRef:    https://rdap.arin.net/registry/entity/NOC32014-ARIN

OrgTechHandle: NOC32014-ARIN
OrgTechName:   Network Operations Center
OrgTechPhone:  +1-347-875-6044 
OrgTechEmail:  [email protected]
OrgTechRef:    https://rdap.arin.net/registry/entity/NOC32014-ARIN


#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/resources/registry/whois/tou/
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/registry/whois/inaccuracy_reporting/
#
# Copyright 1997-2021, American Registry for Internet Numbers, Ltd.
#

This page displays the publicly-available WHOIS data for 167.99.141.59, which belongs to an unknown organization.

Recently Reported IPs:

** This Document Provided By AbuseIPDB **
Source: https://www.abuseipdb.com/whois/167.99.141.59