AbuseIPDB » WHOIS 182.210.63.101

182.210.63.101 IP Address Information

ISP LG Powercomm
Usage Type Fixed Line ISP
Hostname uniqclenas.duckdns.org
Domain Name powercomm.com
Country
City Seoul, Seoul-teukbyeolsi

uniqclenas.duckdns.org

Subdomains

  • copernico
  • sadale
  • papers
  • cubezzz
  • pzxfajfyqci
  • aaqcehts
  • bugfreeblog
  • wgl.frail
  • yourdomain
  • extend
  • navanspi
  • yghxjecpg
  • zclbex
  • zesewsfi
  • lawnchairmirror
  • tuwsphere
  • isazgzkt
  • qwsgqeyyk
  • wuhwjheguw
  • roskomnadzor-mudaki-konchennye
  • roskomnadzor-parazity-sranye
  • smena-pola-i-gay--sex-eto--kruto
  • smena-pola-i-gay-sex--eto--kruto
  • eatpkttss
  • reyqxxwdj
  • hvfektuhkqk
  • chpprhhuyexq
  • aevwfghsgg
  • pwvpqgifj
  • xsrtgzhs
  • 2ni-explo
  • pvguqktwj
  • kzkqvipuf
  • sfvrjkgp
  • xdroq8vz
  • pjqwppawkq
  • intensovet
  • nabile
  • mobile-legends
  • dqefxaqi
  • jdryardfa
  • dhqxxitsigiu
  • ziezetgk
  • itharagaian
  • xshaekckri
  • appsbydavidev
  • mywebserver
  • skelectronics
  • reukiodo
  • zrvcpsqk
  • wimpanzee
  • blog.lbehrens
  • hypercube-software
  • goosecloud
  • togetherjava
  • lightningbolt
  • udqfquuzjewg
  • iknowu
  • auvfpzhdg
  • inforcustom
  • vm1
  • kirppustan
  • hhddratcq
  • mydomain
  • woodamba
  • lekili
  • lbn.frail
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.auth-01vnftdmtdsegbkg
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.fifth-third-auth
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.itstkennedy
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.pwkywiezkd
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.surstrommen
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.vsusbsbarc
  • autodiscover.43349671317
  • cloud.lnxt
  • cpcalendars.10460677114
  • cpcalendars.11062170815
  • cpcalendars.50933547218
  • cpcontacts.postmain-deskhelppagetxid65
  • cyshbiupvw
  • eurovetplus
  • femine
  • homeilazz2
  • kalaenne
  • kiashan
  • lavirgen
  • lkcytplgye
  • n2x7lvd6
  • nextcloud.isisamba
  • oagdaxkgrq
  • qkmu7745b
  • qpixellk
  • vmjjz6
  • vscode.gkaras
  • webdisk.10359252412
  • webdisk.10675109116
  • webmail.11285946802
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.dvr
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.hadiah-ffgratis27
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.helsinkicloud
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.info-amazonupdateaccountiivtrfh
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.matrixomega
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.npzlmavysg
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.renci11
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.y4663n
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.zbchzfirpg
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.zjoboejlrp
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.znhsdoibtg
  • 038d159d-b3bc-44dd-a0c4-bec68c0c4123.random.zunhome
  • 08107
  • 0beccf26.cpcalendars.ffitemterbaru2021fg
  • 0igstpdbpq34iw0xm5ucoa2zyrdyd0hxe36xgmvnxtyl2ye764suiqrpdbe46ln.sasnas
  • 100074358608
  • 11140621304
  • 123321123321
  • 16840998616
  • 16walgrovemews
  • 18071782735
  • 1d9da0b61b.jebany
  • 1i3
  • 1n06ce
  • 1rr5tva
  • 2019.jlvdd
  • 2019.marekhassio
  • 2019.santpau
  • 2019.sg74hsh
  • 2019.themassrelay
  • 2020.attreg-registrationweb
  • 2020.barbdeaon
  • 2020.nunesreality
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.atb001emby
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.tsptcloud
  • 284d
  • 2ukoxo8y
  • 2w5os77f
  • 2xsbzf2c64dr9b8azn0fn89ivvrunhusyu333cr6nh3kesz5k5a4762exbc6aa6.pp549
  • 3-trq-ll-thwr-l-wzyf-tnzyf-lmnzl.ktb-ldrst-lslmy-fqh-thny-mtwst-f1-lfsl-ldrsy.mkfat-lkzynw-lmkhtlf.hm-sb-m-yyr-twhlk-llhswl-l-ltmwyl-lshkhsy.fdl-lkzynwht-l-lntrnt-ll-byn-fy-mn.d-tdwyr-lnfyt-lshsh-lhtzz.www89
  • 32zxvfjxj
  • 3gadc8
  • 3is
  • 3jnd22fkp
  • 3li4jm
  • 3narfb
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.1zhb0e
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.28olviwtz1msj1qvrhqscaxojlikelhy8pxoa
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.darkseed
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.embyyuri
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.fazertest
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.hachaschbjdbckdbckjbdkjbcdkjbaskjcb
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.hscebcsecure0binfo
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.myclouddrala
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.njstein
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.qcyozoivif
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.unithub
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.warzonehomea
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.yvkttnevsz
  • 432866767708
  • 43387977902
  • 4b4eceir5
  • 4esewainc
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.818bonifant
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.houstonradarr
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.wgcenter
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.0jegiq
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.6anoh2swc
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.abboc75
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.apollo-home
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.btnzhggrrf
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.elleffe
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.jamgold
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.moxvsjcfmx
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.oiltkoipenk
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.omllizvtrq
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.po74kq
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.preqububay
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.rsm
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.rytl
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.szymrkptcb
  • 54347b2e-cd2f-42d0-bbfc-122f5091eecc.random.zero4vaultwarden
  • 57dorsetha
  • 5fghfgh
  • 5huxley
  • 5ngz0q4
  • 613141667
  • 61nw82s
  • 65uf5r54vrq0p9t9.zcghcozmqo
  • 675f
  • 6eu94o4cdtf4jxla.uraa-22
  • 6p7opx0
  • 70ja62
  • 776ynji
  • 77days
  • 789654321409
  • 897649874896
  • a-simple
  • a54jlw
  • a8uehibh
  • aarongk7
  • aaronj09
  • aaronn94
  • aaronqkk
  • abachiv2.duckdns.orgabachiv2
  • abejarano
  • abgoute
  • account-settlngs
  • acessonline
  • acetamid
  • acviserver
  • adasjfaskjfhkasfsaf
  • adawedding
  • adesso
  • adhocit
  • adiddas
  • admin.oneshoos
  • admvvilloria
  • afnimpia
  • aguete
  • ah2fil0
  • airsonic.mathie
  • ajqkhxscge
  • akb8f3hso
  • akhz
  • aklrmcuxth
  • alberfio
  • albertvl98
  • alex2kdl
  • alexis-miller-b7z4.blog.mta-sts.sage-server
  • alhtzkuvdm
  • allahseven
  • almr
  • alphalevo
  • altoca
  • ambiancenew
  • ameiica09i-scuirie0e7
  • amjkajjldy
  • amydppbazz
  • anavasis
  • andersonfam
  • andrisvacigaep
  • anfamily
  • anhaco
  • aninprev
  • anneas
  • antm
  • anton108
  • antone
  • aob
  • aoxafwus
  • api.izantech
  • api.together-dev
  • apkrishome
  • aqasqwqsqa
  • aqsxvxncsx
  • archieclayton
  • arduxmon
  • arelscaisseregiont
  • argan
  • arkmce
  • arminsoctopi
  • armours.black-v
  • aronmosagata
  • ask8077
  • atardif
  • atenav
  • atom-ha
  • atreeks
  • autodiscover.10822308402
  • autodiscover.116743581301
  • autodiscover.32376604805
  • autodiscover.nmhfy
  • avifilmoukq
  • awfpaehzwv
  • azjpuxhetc
  • b-rad-pad
  • b11jqn
  • b4ky2ak9s5ons2909er829n0c58l22iruz3bal2p0ne8fzkruch9ysaswkhrcno.grup-pap-cantik2022
  • b4m386
  • b6bc745a-7b5c-4d56-ab6c-0dd2982cb122.random.smilence
  • baatniawck
  • baavgcizbq
  • baclain28
  • baebae
  • bagi-budle
  • bancfst1
  • barnr1ggu7i82r9x2bq2cd9f1vt5sw1n2hgfn02df8ohsqg2p306y09qoc9l7l9.asj9dan
  • bassrempta
  • bawioqro
  • bazlewdcal
  • bbntdl
  • bbwolf
  • bchester
  • bcuclntaxr
  • beautiful-now
  • beepboop
  • berdin-homeassistant
  • beverlo
  • bfre
  • bgmpozbqzz
  • bgronas
  • bholdher
  • bibliopdslr
  • bibliopdsud
  • bibliopdtgt
  • bigbandvod
  • bimetallistic
  • binxcottage
  • bitwarden.oficina365
  • bizqysbgth
  • blomfeldt
  • bmdvrtjsvw
  • bne4s4q
  • bokepviralterbaruxyx
  • bolesti
  • bonsvins
  • boothyflix
  • bpqyxwrctz
  • bpwutcndps
  • bqicpnfwbe
  • bracci
  • bronindon
  • brrsxyluxd
  • bsbmezyujz
  • bsooljrk
  • bsoolq86
  • bsudol
  • bupders19tai
  • bxlyysstku
  • bxng
  • bxyitfpqlx
  • c6mooota7
  • cablesalty
  • cagorkao
  • calendersport
  • calibreweb.dellubuntu
  • calinogsmarthome
  • can-i-add-monthly-and-once-only-payments-patreon.dersre20plic
  • canonry
  • capcharemo
  • carjpkazke
  • carlosgtcloud
  • carnadeno
  • carolvx1272
  • casarick
  • casastewie
  • catepa
  • caueg1
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.grandhotells
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.lsekcfhdbk
  • ccpwppsxqk
  • cctrevxc
  • cctrf4ua
  • ceicke
  • ch101
  • charlottedaniel
  • chatlumo
  • chevygaming
  • chfgunirem
  • chickenplucker
  • chiefha
  • chriscraftmap
  • chthksesho
  • ciaspeakes
  • cilantro
  • cisukwaobx
  • citizensauth05
  • ciyw
  • cjadmnbxda
  • cjba
  • claim-event897old
  • claim-hadiah-freefireterbaruu
  • clasjuicred
  • clfjldjlum
  • clios
  • cloud-sudeste
  • cloudsecurity
  • clouok
  • clubigiz
  • cm4sata
  • cntrstf
  • coadzssrtg
  • cobblemme
  • coda-32
  • codashoop-event-2021
  • codashop-ffeefire-max-garena-r2
  • codazhop
  • colect-skinmlfree
  • comm-2
  • conjuror
  • consols
  • controllocasa
  • cottontail-labs
  • coubi64
  • countryside
  • cousinhood
  • cpanel.10822308416
  • cpanel.14878952720
  • cpanel.1jojcby40f
  • cpanel.47geez
  • cpanel.a.garena--freefire2021kk
  • cpanel.amanawalian
  • cpanel.amzn-de-signin-871lupaharit21-161
  • cpanel.appleid-icloudservice
  • cpanel.b-pubgmskinsfrees18
  • cpanel.baurmam
  • cpanel.bkpmediafiretrbaru
  • cpanel.buruan-ambil-skin-gratis2022
  • cpanel.cashappstepbystepverify
  • cpanel.chat-whatsappp-com-grupxxx22
  • cpanel.chiphigssdominogratis2021
  • cpanel.citizensonlinesupport
  • cpanel.claimfreediamondff2022zx
  • cpanel.claimitem990dz
  • cpanel.clamhadiahfreefire
  • cpanel.codashopfreediamond-vips
  • cpanel.codashopidff01
  • cpanel.confirm-yourfb3w
  • cpanel.dominoislandchip
  • cpanel.event-freefiregratis2021
  • cpanel.eventclaimy
  • cpanel.eventffgratis999
  • cpanel.eventgratisresmigarena
  • cpanel.eventresmi.garena-freefire201
  • cpanel.eventrsmiffskinbundle
  • cpanel.freefire-item-old-xyz
  • cpanel.grub-viral-18-detik-2022
  • cpanel.grub-wa-janda-melehoy
  • cpanel.hadiah-freefire-bg
  • cpanel.its-freefire5
  • cpanel.joinchtt1.grupindviral18
  • cpanel.klaim-hadiah-gratsi-2022
  • cpanel.lucky-crate
  • cpanel.manageorderprimeelimited
  • cpanel.mlbbeventskingratis
  • cpanel.netflix-01
  • cpanel.newevent21
  • cpanel.onlineserv7a-user
  • cpanel.rendirengers.item-cobra-gratis
  • cpanel.s3cur3inf10-us3r
  • cpanel.secure011
  • cpanel.securedauth-verify09d
  • cpanel.secureonline05
  • cpanel.spingratisffterbaru2022
  • cpanel.tamrneskeo
  • cpanel.topuppp
  • cpanel.tretyyyylink55
  • cpanel.ups01verif
  • cpanel.userverify-auth1
  • cpanel.viral-smk-vya
  • cpanel.web-event
  • cpanel.yudagantengbangetslebewww
  • cpanel.zafarrtu
  • cpcalendars.76418919711
  • cpcalendars.83382642110
  • cpcalendars.ambil-itemff-gratis-resmi-garena
  • cpcalendars.ambildisiniclaim
  • cpcalendars.appservr213ance-com
  • cpcalendars.auth-mxsdoqwkoqwhtifsadqewgasd
  • cpcalendars.bokep-viral-indo-2022
  • cpcalendars.chapter100
  • cpcalendars.chase-mu1-veri1y
  • cpcalendars.chatt-whatsappp-comm-dau-inbvvt-emwn
  • cpcalendars.claim-event90old
  • cpcalendars.coda4game
  • cpcalendars.codashoppro-new75
  • cpcalendars.cpsessamazon5945016209
  • cpcalendars.dropboxdocument
  • cpcalendars.event-freefire114
  • cpcalendars.ff-codashopeventnew
  • cpcalendars.group-whatsapp-notnot8
  • cpcalendars.grub-berbagi-videoviral18
  • cpcalendars.grup18-2022
  • cpcalendars.grupvidioviral253
  • cpcalendars.hadiah-dari-bang-dylan-pros
  • cpcalendars.hellbelo
  • cpcalendars.id-boa
  • cpcalendars.kampret34
  • cpcalendars.kiwkiwkiw2
  • cpcalendars.linkkayesmediafire
  • cpcalendars.login-infinix
  • cpcalendars.meanpoomper
  • cpcalendars.membershipp201
  • cpcalendars.muhammadrizky
  • cpcalendars.nzviralls
  • cpcalendars.pageclient-userdesk0060
  • cpcalendars.potatostore
  • cpcalendars.poypal01-cc
  • cpcalendars.profilevalidation9q-authlegalaccess
  • cpcalendars.pubg-mobile-new-event
  • cpcalendars.servicecsamz506
  • cpcalendars.signuyanyfzp4v
  • cpcalendars.spin.lucky-spinfreefirefree
  • cpcalendars.spinfreefirejune
  • cpcalendars.trend-ff-list-mitfabegoanjingk11
  • cpcalendars.vidio-bokep-free-sampai-crot
  • cpcalendars.viewshare-doc
  • cpcalendars.virallnihhh59
  • cpcalendars.xzonebilling
  • cpcalendars.yanskecenich
  • cpcontacts.09713721
  • cpcontacts.53-content
  • cpcontacts.54738393804
  • cpcontacts.accountverif001
  • cpcontacts.ambil-hadiah-free-2022
  • cpcontacts.bayramkampanyasi900tl
  • cpcontacts.bok4p-freexxjoin8
  • cpcontacts.c2i3ti
  • cpcontacts.claim-bug-garena-ff-2021
  • cpcontacts.claim-event-freefire-garena-free66
  • cpcontacts.claim-event-resmi-dm-reeaed
  • cpcontacts.claim-new-event-freefire-2021-2022
  • cpcontacts.claimggold11
  • cpcontacts.claimhadiahfreefire25
  • cpcontacts.codashop-freefiregg27
  • cpcontacts.codashop-new-event03-2021-oktober
  • cpcontacts.con-nctobwe3llzinfo
  • cpcontacts.event-codashop-allgame6
  • cpcontacts.event-freefire-656
  • cpcontacts.event-freefire098
  • cpcontacts.event-garenaff48
  • cpcontacts.event-sg-max3
  • cpcontacts.event-spesialaniversary-freefire2021
  • cpcontacts.event-terbaru-2022iss
  • cpcontacts.ff-bug-garena-dm-1288
  • cpcontacts.ffindo-unipin
  • cpcontacts.garena-codashopgratis3
  • cpcontacts.giveeawayyanggun-wili21
  • cpcontacts.grup-viral-terbaru-hot029
  • cpcontacts.hadiah-ff-terbaru
  • cpcontacts.hadiah-ffbgid-terbaru
  • cpcontacts.hadiahgarenaff7
  • cpcontacts.hadiahgratis-venomfreefire
  • cpcontacts.jomctlutknksmes
  • cpcontacts.mediafire-viral1983
  • cpcontacts.mistery-resmi.event-private-tersembunyi
  • cpcontacts.nana-whatsapp
  • cpcontacts.newspinfreef-2.newspinff-21
  • cpcontacts.scured02sklink
  • cpcontacts.scuure43
  • cpcontacts.securerande
  • cpcontacts.securevcncac0
  • cpcontacts.server08-wellsfargodx
  • cpcontacts.sgntpwunqjals-prchseoqpausnw
  • cpcontacts.skinmlbbgratis2021
  • cpcontacts.spin-ffterbaru123
  • cpcontacts.tiktokskandal69
  • cpcontacts.verifyonline01
  • cpcontacts.videos-viral2021
  • cpcontacts.viralrandomvideo
  • cpcontacts.wkskskakak2022
  • cpcontacts.zeven
  • cpgiwanojk
  • cr1t1cal
  • crazyasyou
  • created12465
  • credda11
  • crotaia
  • csopyccaes
  • cstsdcdmxl
  • ct51x76
  • custdev
  • cutcombe
  • cvc1
  • cvepyakxnp
  • cvpjime
  • cxognxmeks
  • cynlffljgc
  • d4fl0w-hass
  • daha
  • daniellebaloo-nsfw-patreon-pictures.micon55in
  • darkbro777
  • darkkurbaney
  • darkmattos
  • darkturbolight
  • dartmune
  • datingo4481
  • davis-holden-home
  • dayros66benz
  • dazzlingweb
  • db.servi2r
  • dchawebhook
  • dcinemay3u
  • ddeluge
  • ddesqi4
  • deaqnjbeia
  • dememer
  • devrandom
  • devrasp
  • dew-daw
  • dfpfuscgbm
  • diawolf
  • die-weber
  • diego-home
  • dilchxpfze
  • dinonet
  • discava
  • discover-africa
  • distopul
  • djqiqrkwhr
  • docs.16kh
  • domopinode
  • donkievault
  • donnamt5287
  • donsalvatore
  • doping
  • doublew
  • downloads.netwerk
  • drlevent
  • drnavtransmission
  • drouleztest
  • druck
  • duck7okmyqoiq2
  • duckk4ka0h6rtc
  • duckm3jgzveq7z
  • duckvpn9s2dav7
  • duckytime
  • dunthesu
  • durchcodive
  • durchmarlers
  • dutchducks
  • dvr-amp
  • dywnnkjfba
  • ebook14
  • ebooks3eh
  • ebookz6
  • eccentric
  • ecodeck
  • ectvodvzrr
  • ecuado2021
  • edibleelegance
  • edigkmotwf
  • educasa
  • eewwxrwxwd
  • egoufmiupy
  • ehdnddlnxk
  • ehnplpnmih
  • ehsferdqco
  • eiftyha
  • ejijpmkfjm
  • elguapo
  • elz-server
  • emcrom47bran
  • encrypt-alexa
  • eniubk
  • enoxmklxfm
  • entlgpxdaq
  • entuyzdgent
  • eo93pl
  • epssistem
  • epubty4g
  • eralpane
  • erfyrvqvcu
  • erifri
  • errxeyetho
  • esbzxzhrng
  • esmentho
  • esphomecasa1
  • espomrxltt
  • etujyskoqa
  • etwh
  • eueowhjdc
  • eurovtt
  • evennt.createold78
  • event-new
  • eventfreefire72
  • evidapzjxl
  • evityuk
  • expolirin
  • extellion-craft
  • eybbrvguqe
  • eywxhbfdvf
  • ezwsocxrqn
  • f12b26n6qex0bd1x68lhks2gqjhh51tdovnqqtjxdbak2csassi2hwetk40kwj2.sign-amazonupdateaccountneovror
  • fabioreg
  • facebookmobile
  • fadeto
  • fantas
  • fb-ms.ptidea
  • fbjrmnuhrln
  • fbook6889
  • fdunzfszsm
  • feagle
  • feedbuv64
  • feedgj
  • feqewjjkxx
  • ferreterialuismicentral
  • fetidi
  • fexddeewpy
  • fezfzf3f
  • ff-event-spin-old8
  • ffeventnew
  • ffilmt2bt
  • ffilmtcol
  • filebrowser.oplex3
  • files.baothi
  • fillserver
  • filmdotavucp
  • fjtomwh
  • fkrrfxua
  • fkuifzrzlu
  • fkzqzhhddt
  • fmbmqsexlm
  • fongwei366
  • forktointernal
  • fortnbookwep
  • fortnbool026
  • fortnbool32d
  • fortnbool651
  • fortnboolcns
  • fqfujkznik
  • frabbzbqce
  • franagua
  • fraseryvette
  • fredefland
  • fredericocassola
  • free-join18plusxnew
  • freefire-max-eventnotnot0
  • fruitfully
  • fsenika
  • fsztzsnudo
  • ftp.ip4
  • ftp.lk21
  • fuentes331
  • furkanolmez34
  • fvhjosujkg
  • fwplllfklv
  • fxlvklzydn
  • g4bux
  • g7nextcloud
  • gamelle-api.wcs-lyon
  • gaqkwatnep
  • garena-coda
  • garena-eventnew61
  • garena-freefire-vvip19
  • garenaeventt245
  • garenafreefire15.gratis-event18
  • gasavan
  • gassistant
  • gat3way3
  • gbdusypibc
  • gbtnakuace
  • gdssweac
  • gehm
  • gejafqap
  • geraniols
  • getflnf8
  • getfls4g
  • getflwrs
  • gfbwikvcjl
  • gfsddhrttttt
  • gfvdsjyj
  • gght
  • ghcftguh
  • ghosthunter
  • giftfreefire-eventt
  • giltheads
  • gireotlkdy
  • git.git.git.ageless-warrior.com.fr.sts.detmer
  • git.git.git.gitlab.git.git.git.git.com.casts.detmer
  • git.git.git.gitlab.git.git.git.git.comme.com.detmer
  • git.git.git.gitlab.git.git.ktownconcrete.comects.detmer
  • git.git.git.gitlab.git.git.ripple6.tkg.eus.detmer
  • git.git.myolitabs
  • git.git.ngeriyahajarin.comato.xyzw.sts.detmer
  • git.gitlab.git.gitlab.git.beta.ename
  • git.gitlab.gitlab.gitlab.megapari.clicks.detmer
  • gitea.mock
  • gitlab.git.git.astiteklab.com.montiimpianti.eus.detmer
  • gitlab.git.git.git.gitlab.git.cost-co.online.eus.detmer
  • gitlab.git.git.gitlab.e-cure.ingit.fr.sts.detmer
  • gitlab.git.git.gitlab.gitlab.beta.ename
  • gitlab.git.git.gitlab.gitlab.git.git.tasxrewvgy
  • gitlab.gitlab.git.webdisk.ff-evnt-com
  • gjfymqhofz
  • glatzner
  • gled
  • glnippbyxp
  • gobbkongjoo
  • gogs.sentimens
  • goldop
  • goztnaseqs
  • gqgodnkpsp
  • gqtrukrhxd
  • grcruqzrzn
  • grecolombiano
  • grocy.casaviaverde
  • group-wa-virall2
  • grup-dewasa-tante-hot2021
  • grup-mabar-efdewe
  • grupbidadari18hot
  • grups.freefirebgid
  • grvzodww
  • gta3
  • gtahthbfmw
  • gtjresqyxr
  • gxtvlpgctb
  • gypomots
  • h2v4sgv
  • h4
  • ha-39
  • ha-lansolo
  • ha-nizza
  • hack3466
  • hackbook
  • hadiah-diamond-skin-hari-ini-2022
  • hadiah-garena-agustus122
  • hahabee
  • hahome505
  • haiuuesjlm
  • hannazpdf
  • haosin
  • happjg
  • hass-bergstrasse
  • hassio89b
  • hassiobanan
  • hastraq
  • hauk.greenparrot
  • havighorst-asisstant
  • hbgarena
  • hdecajcmyp
  • heisenberg72
  • hgaehknioq
  • hgqiafbkcs
  • hinuzdaz
  • hisienkhome
  • hjk31zsre98jh
  • hjkj4dt
  • hkfrfaxrae
  • hliocltpsp
  • hljxqc
  • hmbiaubzbl
  • hnrlinux2
  • homeassist-dz
  • homeassist-stream
  • homeassistant.thelonelyisle
  • homeassistantjensmueller
  • homeassistantjswg17
  • homenetworks
  • homer.cathd
  • hoopole
  • hoylakesc
  • hptn27
  • hqfkcgygzz
  • hqxmhiwnps
  • hrrebqxruc
  • hrtsidugsidodbido
  • hs-omv-nas
  • htlhognazn
  • huaygsrqeg
  • huntington-mobiled
  • huyquyengameminh
  • hv4bhwo696ni14ajv1vkc9te151yhi5s1porw4y3ig5uq5unijw8slw7e16chsy.analytics.secur4me
  • hysyzlcqax
  • hytoro
  • hyyqrvhjyq
  • i-n-r-i
  • i00
  • i7l
  • id5p8m2e
  • idovmoqvko
  • iekf3qxb0
  • ifgncbsuvh
  • igualmente
  • ihktzqtwxv
  • ihmvllahpn
  • iigitcnhfm
  • ikatatiovia
  • ikradomotique
  • illustrator2008
  • ilmuwiki.coms.detmer
  • imberthome30
  • indissuadable
  • infectadito2023
  • info-resmigarena2
  • info.doanlock
  • inlasis
  • insemibee
  • iotautomation
  • ipurpomkka
  • irismin
  • irpfkxjaez
  • itemoldspin2021
  • itfcbpmfzv
  • ithome
  • itsuj
  • itxpebjotc
  • iufapnow
  • iujaxuim
  • iujqvnpfew
  • iwiny
  • iwp
  • j3rusal3m-94
  • j97jlnfp1jx27gkbd294qunmlsar06wc5mjfuqmqn9zaw2e6gxra40huqd3q3wd.royalexguardm7
  • jaavfrnsfl
  • jaimeotero
  • jamarloro
  • jandepora
  • janganhapuscok
  • jaxklag
  • jcchaquihome
  • jcdaydomotic
  • jdvhinktkn
  • jeffreyricardo
  • jeremy923
  • jeremyelise
  • jimmydelgado
  • jjh-mqtt
  • jksatel
  • jlv-sgaming
  • jnmps
  • jodhcogeb
  • johan-ha
  • johnston
  • join-fastestproxies
  • jokernio
  • joplin.bashbox
  • joplin.debsidian
  • jordur
  • jqhgukmxhg
  • jrd0shh
  • jtjmnmta-sts.mta-sts.kuplex
  • juanlu42
  • judith
  • julianovarelacg
  • jumejkiv
  • jvgfhujimr
  • k9pm7i
  • ka4cy76
  • kai-ming
  • kaizeen
  • kamranizcool
  • kantarella-patreon.cioucons74na
  • kapwdbfhpa
  • karolev
  • kauprotmoons
  • kaxqdf
  • kaylx
  • kcnklbplfn
  • kgbwsokfnw
  • khfminswvq
  • kid6
  • killasj5
  • killaybm
  • kingpower
  • kixofxmkng
  • kj6weg
  • kjiudbrtt
  • kjwiwrdlxt
  • kkihg38s
  • kkihg7t0
  • kkihg8i3
  • kkihgbh0
  • kkihgc60
  • kkmddkdkd
  • klaim-kiriman56
  • klerlvq
  • klmmayaki
  • km-bponc
  • knockback
  • koivuhaka
  • kojyfvau
  • koprefd
  • kptcoukilm
  • kpulapeshte
  • kr-1
  • krfkrzimvj
  • krk24hk
  • kromol
  • krystian8001
  • ks.bknas
  • ksvc
  • kureshiki
  • kwoljgavmw
  • kxnfokodhy
  • l3bp1kqmm0qzlarmngtx
  • laalvrqrhf
  • lacubu
  • lamer01
  • lamolela-ha
  • lasxa1s
  • laure
  • lautech
  • lazymachine
  • lazypi
  • ledlabs
  • legerdemain
  • lehealthrunge
  • leicarre
  • leitanca
  • lestate
  • lezmmcnqvj
  • lfjytqfnfqm.galapagon-ha
  • libricuzus
  • lightiti
  • lightvil
  • lilliepdfzip
  • littlesaurrex-adult-video.hoede55texp
  • ljitpxcmlu
  • lkxdvpea-koffnxmeadjga
  • llosqg3
  • llosrb7
  • llot14d
  • llwlogkn
  • lmss
  • lokumthecat
  • lopped
  • lopstrk5
  • loremagnopi
  • loucomar
  • lourigaou
  • lozit
  • lperssuivq
  • lrenomoxfu
  • ltnmotycds
  • lucky-spin-gg-new
  • luckyroyalespin1
  • lungkjis
  • lupe4hg56jc9die46mg8agmynwbye1bd9ug9diqxzge874n25rsyub4vyv0t4i1.cloud28
  • lvoxevrjpw
  • lvynmvwdpg
  • lwagpqapzq
  • lzrwwkbdiu
  • m-k8s
  • m0d4r-4mazon
  • m2f
  • m9bn1wpi
  • ma131.tchct
  • mads-mediaserver
  • magonew
  • mail-casa
  • mail.02secure-auth
  • mail.1.neweventff-garena8
  • mail.13456630206
  • mail.52120669501
  • mail.abiiayua
  • mail.allaskausasupport
  • mail.anjaialok
  • mail.anjc-eventmenarik
  • mail.bukamutnaksuono
  • mail.citizensbankloginaccessunlockedma
  • mail.claim-efootptballpoints
  • mail.claim-hadiah-gratis-2021-1
  • mail.claim-hadiah-gratis205
  • mail.claim-item-baru-ff
  • mail.claim-itemoldgg-2021-1
  • mail.coda-dm67
  • mail.codaffgg51
  • mail.codaship-event
  • mail.codashopallgamegratis777
  • mail.dominotopbos
  • mail.even-terbaru
  • mail.event-garena-freefire-terbaru2022
  • mail.event-pubgmobile73
  • mail.event-spin-bundle-new-com
  • mail.eventfrfirespinn
  • mail.eventgratis-by-kulgar2021
  • mail.eventgratis2023terbarufree
  • mail.ff-garena2
  • mail.ff-gggamevo7y
  • mail.ff2021free
  • mail.first2gga
  • mail.gabunggrupbokep18
  • mail.grubviralterbaru
  • mail.hadiah.coda-gratis
  • mail.holdservicecenter2
  • mail.jcoinbase
  • mail.join-grup-dylanpros-01
  • mail.k2-server
  • mail.link-mediafireterrbaruu2022
  • mail.lopio-market
  • mail.lowongan-kerja-22
  • mail.mauakun01
  • mail.mindapfer
  • mail.mlclaim-21
  • mail.nfidsecu-03id
  • mail.oktober-misterishop-gratiss
  • mail.parah.dibawahumur
  • mail.personal-internetbanking-bankjago
  • mail.secu05c-tr
  • mail.secure04bchase-onlineaccnts
  • mail.serversmtp
  • mail.servicecsamz460
  • mail.sign-amazonaccountupdateepjxyrl
  • mail.sign-verifyaccountamazontezworco
  • mail.undangan-grup-youtuberrr
  • mail.verify-secure1
  • mail.webapi-support-dashboard-chase
  • mail.wellfarg0-secure
  • mail.wwww-halosalhshss-2022-xyz
  • mail.xxxcom61
  • mail.yuniopl
  • mail3.digitalspec1
  • maior
  • maison-moulin
  • majumaq
  • makedime
  • malavika-mohanan-photo-leaks.izden27neu
  • malorange
  • malusdreef
  • mandino69
  • manual-pulse-generator-hs-code.despsa69ca
  • manue-steph
  • maphastron
  • margaretdch
  • margaretfv2670j
  • mariozelaschi
  • marnal
  • matthewchu
  • maung
  • maywood
  • mcatelet
  • mcuolrxnkr
  • mdskszl
  • me.qw0
  • medinahome
  • medns
  • meey
  • meiden
  • mektlev
  • melodi99
  • menpa14flex
  • mentwunhaps
  • metoai
  • mhjhujakcr
  • michaldomains
  • milotic
  • minecraftkronos
  • minkvpn
  • mirzacraft3
  • misihome
  • mitthem33
  • mjglspdbnt
  • mkectiboks
  • mladovof
  • mlasaquadz
  • mmnas
  • mnlijfwuyv
  • moaqjaqglf
  • mobile.enkay
  • mobile.twitter-luss
  • mocfqthmql
  • mokjes
  • molyanov
  • momokun-adam-eve.regna76ex
  • mono-nas
  • moorheadhome
  • mostikov
  • mourlonhome
  • movdivxtu8
  • mr6065899213
  • msbkcoyhhz
  • mta-sts.afu
  • mta-sts.auto.carotist
  • mta-sts.bananasushi
  • mta-sts.cpanel.mototalk
  • mta-sts.epshtein
  • mta-sts.explosion
  • mta-sts.fingerpost
  • mta-sts.gdyr
  • mta-sts.illtempered
  • mta-sts.istock
  • mta-sts.ledger
  • mta-sts.llamavis
  • mta-sts.mastermage
  • mta-sts.mendesh
  • mta-sts.menilville
  • mta-sts.mpserver
  • mta-sts.mta-sts.belzebu
  • mta-sts.mta-sts.boos
  • mta-sts.mta-sts.bu3
  • mta-sts.mta-sts.duynstee
  • mta-sts.mta-sts.emeryhome
  • mta-sts.mta-sts.jgnas
  • mta-sts.mta-sts.jobresume
  • mta-sts.mta-sts.lanceuppercut
  • mta-sts.mta-sts.majoco
  • mta-sts.mta-sts.mta-sts.dashony
  • mta-sts.mta-sts.mta-sts.km-hass
  • mta-sts.mta-sts.orgathhome
  • mta-sts.mta-sts.roosteruploader
  • mta-sts.mta-sts.sfossen
  • mta-sts.mta-sts.tomdoc
  • mta-sts.nxtcl
  • mta-sts.pmachomeautomation
  • mta-sts.porn-6
  • mta-sts.savedoc
  • mta-sts.test11.jakobi
  • mta-sts.timelogstudio
  • mta-sts.tv.staff-house
  • mta-sts.webdisk.1jroji6mtux
  • mta-sts.www.get-skin
  • mumtohap
  • muraves
  • mxore2
  • mxova54
  • mxzsgiclpo
  • myanonimedns
  • myhijlgrqw
  • myqxnycuux
  • mysqljunesensei
  • mzug362
  • n5lj9buz
  • nasjuanlu
  • nasmg
  • natanbnu
  • natemedia
  • natena
  • nbgailnzbb
  • nbits
  • nbqefefedr
  • ncforme
  • ncmagnuserver.magnuserver
  • ncmzwhapmf
  • ncvit
  • nekopotato
  • nematomorpha
  • neodogtkin
  • neshomelab
  • netbox.prd.it.unity3d.comgit.cuyulas.jp.com.sts.detmer
  • nextcloud-maxoal
  • nextcloudskopad
  • nextdeta
  • neyat
  • nezahybels
  • nginx.jetsi
  • ngwazi
  • nhhpvcyria
  • niceqple
  • nickphone77
  • nikovehrens
  • nimhxhztkz
  • nineubxhtc
  • njbhlevawo
  • nkudk
  • nllmmllkky
  • nmfworld
  • noilisu
  • nontabular
  • nonton-viralbokepindofull22
  • norhat
  • norplay
  • norrelin
  • norwickst
  • notif.mad-cow
  • npm.camblight
  • npzynssvns
  • nqbgzxgged
  • nqgggtxyqg
  • ns.fiarr
  • nsld
  • nstwxsggjk
  • nu28cpc
  • nuzebwcniz
  • nvdcawlizk
  • o5hqbigrux602xvm.zelkowy
  • ocrambdiay
  • ocwlqjlvny
  • odpteepfbo
  • oe3sqz
  • office365microsoft
  • oficinaaguicons
  • ogas
  • ohoney
  • ojfaetciso
  • oldfieldikread-pdf
  • olfbred
  • omard4dr
  • omniparent
  • oneone
  • ongrijpbaar
  • online-promerica-session-9992upup3
  • onlinefilmeztw
  • onsgesinhuis
  • onti93ge
  • ophiopluteus
  • opmpxckehl
  • oref-rs
  • oshaugen-nkvoll
  • ospirulinedy
  • otten-ha
  • ourhouse20
  • owncloud.2gracesrd
  • oxfopyzmnc
  • oyqzvznvep
  • oyytukdght
  • ozxrmwqqfn
  • p13-tee
  • pajkosponi
  • pallet-stackers.abdo1
  • palworld974
  • pan-home-ha
  • parabolical
  • partore
  • passweb
  • patenan
  • patreon-gal-einai.berloa12ment
  • patriciaeq9430
  • paumas
  • pavlustechnicus
  • pbamford
  • pbdyzz
  • pdf-viewer-pro-serial-key.rhoste84pear
  • pdfdemanuasdx
  • pdfty6q
  • pdqfimtito
  • pdumdeaplc
  • pe82qgv4x
  • pedrodomotica
  • pelitweb
  • pellets
  • pfpinto
  • philbowers
  • phillyhoes
  • pihole.darlingserver
  • pilihome
  • pilotaware
  • pincho
  • pineimhdgf
  • pingmaca
  • piratibusoni2
  • pixap
  • pjyjrexhcz
  • plex.feliks
  • pmgbnjdxuo
  • pns1pps
  • pocketsofthefuture-patreon.navab42min
  • poitora
  • pooli1
  • portainer.awsbrizzle
  • portainer.izzecloud
  • portainer.jamstruth
  • portainer.mickael62
  • portainer.ramoncio
  • portocolom
  • portofpt
  • potufilnoa
  • ppheaven
  • pplokuxnh
  • prercaten
  • press.wwp.wzip
  • presubscriber
  • pridvmysld
  • proflyfi
  • prometheus.myxpst
  • propef40ac
  • proxyireland
  • psar
  • psnhlosphm
  • psvkzzhkwo
  • ptvbktuods
  • publicwebserverrequest.cpanel.cyberhunt
  • publicwebserverrequest.radarr.jarvis-center
  • puircmoncz
  • putqnkhewu
  • pve-zis
  • pwgrvzjddc
  • pwlmzpmejx
  • px01nathan
  • pxquvupnym
  • py7s
  • pyloutom78
  • pzbcucatep
  • pztnklzxpv
  • q1w2e3r4t5y6
  • q8rp5
  • qa64uqahraokylueryjurwishsmdsgk
  • qadry
  • qaolety
  • qbittorrent.fishtown
  • qbjnnhfmhh
  • qcfrzg
  • qcrjyawxif
  • qdwjcg.duckdns.orgqdwjcg
  • qgibinscrd
  • qgttyv
  • qjxqwooroc
  • qkek2lbbz8jkciob.zhenyamega
  • qlines
  • qlwnzqwljk
  • qrmcdhrtu
  • qtn1pq
  • quintoelemento22
  • quyver
  • qwaxdjml
  • qwaxdn56
  • qwaxdo0v
  • qwerty0uk
  • qwg227saibrdm6ukrkl3fjbimf36f5edpp5ksjd5gubn95vn8fs6on2dpdnln9g.sekianlamadiawsamazon
  • qxzbdifsfr
  • qzl7wetayq9rxz4ckrjpmd7tyz24ieipyy331fkegors9easbap4xnqcasijxdr.p360ngen
  • r2r-image-line-keygen-exe.rimi52wai
  • racycle
  • raefik.test-arm
  • rafacalamar
  • random.maafkansaya421
  • rashwan
  • ratlllllao
  • ravtdfdtob
  • razaefni
  • rbao
  • rclone.zelab
  • rcynecwagy
  • rdegelo
  • rdserver
  • readty5b4
  • realwill
  • recyro
  • red1rectn-flix0
  • redacaoqetk
  • remsha
  • reno-31770
  • reptiliform
  • resiliosync.thewidowlicker
  • retroxiphoid
  • reverme
  • rewardfreepubg
  • rfertc
  • rfhzefwnpf
  • rgydsxtt
  • rhcjkc
  • ridpnbmeni
  • riecenzano
  • riegespha
  • ripdownroc
  • riqhole
  • rkwgpdhgaq
  • rnwguojpsy
  • roberweb
  • robster3004
  • rocha88
  • roherrci
  • roji6mtux.duckdns.orgroji6mtux
  • ronengg-patreon.nibbro83re
  • roselt
  • rotidhosha
  • rousseau
  • rpeleijpqd
  • rpiot
  • rrctmsrlye
  • rrfkhgkf.demios97
  • rrnrzjsdia
  • rsrflztuds
  • rtbbxffeor
  • rtqyvxfspo
  • rubenvg95
  • rudramalhotra
  • ruthrk91
  • rxxzjgowju
  • ryanstore74
  • ryrtgdilhb
  • rzd.silobs59ne
  • s11rnmc
  • s7x6a3
  • sabi
  • sablefort
  • sanctioning
  • sandroad
  • sarloli
  • scotjnsdog
  • scratchy
  • scure-informations71871
  • sdwzhrjqgzj
  • secure-update9-info
  • secure11biverify
  • seljum
  • semihdikmenli44
  • seputi
  • sesovdfgtp
  • sg-app.duckdns.orguat
  • shaikha
  • simafi
  • simbair
  • simontokksexy050
  • simontokviralmei2022
  • singular
  • sipisopiso
  • siracrat
  • sisterkristy-patreon-pics.discman55im
  • sitance
  • sjfjfbhkio
  • sjtczqbdce
  • sjz-cu-hm-kayodi
  • skfdvqmtod
  • skymaxis
  • slvpnmaster-daishika
  • smallville8vdm
  • smarthome.homeykiller
  • smartmetering
  • smartzeug
  • smema
  • smulvihill
  • sn4ke
  • snibel
  • snkrs2
  • softgasbno
  • softho22pres
  • sokjqosmqh
  • sonar.video-japan-karen-campbell-mnv
  • sowzisopqo
  • sp3
  • spaghet
  • spark-browser-baixar
  • spburxqxtv
  • speedtest.nas.p1tt187
  • spobdllsdg
  • sponmyha
  • spotlightrtr
  • spurns.green-v
  • starbase1
  • sticksmanship
  • stoppernet
  • storminnorman
  • strasdao
  • strasits
  • strasmvj
  • strasp89
  • su7vmn
  • subnetpc
  • sulumansorumsuz
  • superpadova
  • superset.uat.ubjucxwoem
  • supportcitizensbank
  • surkaeybtlvd
  • svedjorna
  • swampertorlaptop
  • sweetpotatoe
  • syncyomi.nulk
  • systahof
  • system32activate
  • sziwgmwxsq
  • szkbqgvncz
  • t520
  • tamocoow
  • tarongers
  • tawlink
  • tazoppkkji
  • tbzpvobsjg
  • techarta
  • terminat
  • termrecove
  • terrellhome
  • test.mta-sts.kulrichhome
  • teuve
  • tezao
  • tffslm
  • tfjiwp
  • tfsyr-hlm-rbh-lml-tfsyr-lhlm.trjm-stkshf-lkhyrt-llg-lnjlyzy.khbr-l-mlt-wlfwrks-investingucom.kyfy-ksb-n-b-d.kyf-thsl-l-ljnsy-lfrnsy-wlqm-ldym-fy-frns.thmyl-tmwyl-wmwsst-mly-lnshr-llktrwny.lfshl-lklwy-mrd.mdh-lw-stkhdmn-dmgtn-bnsb-100.www89
  • tggiuoankh
  • thalilou
  • tharindusupun
  • thevaultstorage
  • thi-eggf
  • thinklab
  • thinsg92
  • thirdtebarn
  • this-is-me
  • thisisadomain
  • thislanismylan
  • thqrockatlus
  • thuisdb166
  • thumbnet
  • thunder123
  • ticora
  • timevicomp
  • tipagol
  • titire
  • tkinek
  • tkjcloud
  • tmxqr02
  • tnradarr
  • tobirie
  • togsagang
  • tojznyaunp
  • toldom11
  • tomynas
  • toobz
  • top-paid-patreon-model.faylan67co
  • toptec
  • torfbisray
  • transmission.blaster82
  • traplover420
  • travel9808
  • travel9859
  • treinsniper
  • trejbyhome
  • triix2
  • trinan
  • trucerox
  • trungtamsuachua
  • ttyrdncm
  • ttyrdpi8
  • tvgujcd
  • twator
  • twentytb
  • twqxhhlzfq
  • tydor
  • tzurfwxitk
  • u0r46lux
  • u4sr2u
  • u5yz2p
  • uabkbkbnxr
  • uairgcdawad921anwhlb0vwu9isjmnufuc3myuno6i8h5hmrtz03vrfjeh0n6u5.dev.event-ff-ressmi-terbaru
  • uakoko
  • uamscgfteo
  • ucz
  • uczzdhmpyy
  • uemivgxrcm
  • uexer
  • ufvischwum
  • uiowehfh23uhfdhsh23rhdshafh082hsdfv
  • uitcwp
  • ujhsbywbhf
  • ukrcenter
  • underwood
  • unolaler
  • unperqua
  • unraid-sieys
  • unraidmainnextcloud
  • unterfeichten
  • unweowaila
  • uobud6904
  • uoiqwueoiqwueoijkljakldjwialskdjwasd
  • uplogger-01
  • ups-cs1
  • ur6rr30
  • urjrxjwwwl
  • usaessayqju
  • ussiik1
  • uszxzqtqqg
  • utlsibrnxw
  • uuwamrpusl
  • uwuye.event-garena-2
  • uyymmzmzml
  • v5m9aejo
  • v7bsvi
  • v94a0hg
  • valdeluzhome
  • vangervenhomeassist
  • vaulthomebit
  • vbq6y59v
  • vbuxgtrhaf
  • vceahesqjr
  • vcenter.joemannix8
  • vchbeztizv
  • vegreboo
  • vemoke
  • ventpubgfree
  • verify02b
  • vfebtrexih
  • vhb
  • viacampagnola40
  • video-japan-maria-hall-kcf
  • video-nms
  • video-search-nsbxsz99
  • villafood
  • vip5c0qtd9pe7yk85taelxqsk5b1iq5yd65hzpgf4ecqsex9wi6jm7ia3cbwfwo.api-ganzprivate
  • vipvns
  • visaproduroth
  • vizard
  • vlswkyoqfa
  • vmarquar
  • volltari
  • von.cashew75
  • vpamjr
  • vpn.rodrigogmor
  • vroby
  • vrtwzpqfsaear
  • vvaliibs
  • vvpdcmvokp
  • vyg011wq
  • w81
  • wagpieyoes
  • wallerstrom
  • wawblxnbrt
  • wayan
  • wbcjdasjxc
  • wbuloklrfo
  • wcewtd9
  • wcpmqsmiir
  • webdisk.11061386110
  • webdisk.11133400608
  • webdisk.2.newclaim-garenayear47
  • webdisk.200000000008
  • webdisk.77869a8b359
  • webdisk.7dh23owieudhoi2w
  • webdisk.952321469729
  • webdisk.accounts-witvia
  • webdisk.bdsfa1
  • webdisk.bokepviralterbaru298
  • webdisk.c0nfirmauth07cinfos
  • webdisk.citizensbk
  • webdisk.claim-ffhadiah6
  • webdisk.claimeventt-freefire
  • webdisk.claimlootcrate-firefreenewss12
  • webdisk.codapaytopupgameff78
  • webdisk.codashop-bug-free
  • webdisk.codashopratis
  • webdisk.codashopterbaru53
  • webdisk.connect-citi
  • webdisk.dyt-lucky-spin-gratis
  • webdisk.event-codashop-topup-gratis
  • webdisk.event-free-fire-termantepp
  • webdisk.event-terbaru008
  • webdisk.eventclaim-freefire2021
  • webdisk.free-codashopmlbb
  • webdisk.fullvideo-vip
  • webdisk.garena-freefireid.itemgratis999
  • webdisk.gratis.eventterbarugameindonesia
  • webdisk.grubbkp-18terbaru
  • webdisk.grubbkp.xyzcomdogrub
  • webdisk.grupsswhatsapp99
  • webdisk.hari-ni-hadiah-ff-89
  • webdisk.ibstd
  • webdisk.joingrupnew01
  • webdisk.klaim-ff-terbaru
  • webdisk.klaim-hadiah-ff-dari-garena2022
  • webdisk.link2022
  • webdisk.mscevntmt
  • webdisk.mtb-dc
  • webdisk.paamsa
  • webdisk.pap-tt-3838
  • webdisk.securechaseinfo
  • webdisk.secured0u3verify
  • webdisk.signindam2ygrcgy
  • webdisk.terbaru-klaim
  • webdisk.verifymymtbww3
  • webdisk.viralnihx-new
  • webdisk.web-garenaasli77
  • webdisk.wells-id
  • webdisk.yle4bgtnoji
  • webmail.000909736
  • webmail.10159002616
  • webmail.11140621304
  • webmail.17gt-ff-com
  • webmail.54738393809
  • webmail.547574336211
  • webmail.992341104
  • webmail.amazn-security
  • webmail.att-tthrd
  • webmail.bagibagivideobokepterbaru
  • webmail.bokep-viral038
  • webmail.bug-luki-999999999
  • webmail.butuhcinta
  • webmail.cawlima
  • webmail.chek-event-gratis
  • webmail.chika-viralz
  • webmail.claim-event-diamond-gratis2021
  • webmail.claimevent-ff-free
  • webmail.claimeventffterbaru
  • webmail.claimeventgarena-new
  • webmail.codashop-diamon-gratis2021
  • webmail.codashop-payment898
  • webmail.crate-claimff5
  • webmail.evemt-clm-com
  • webmail.event-claimhadiah-freefire2022
  • webmail.event-dm-ff-gratis99
  • webmail.event-freefire-resmigarena
  • webmail.event-luckyspinnfreefire
  • webmail.eventfreefirenew12
  • webmail.evnt7-freefire-gratis
  • webmail.evntt21freefire
  • webmail.ffitemterbaru2021fg
  • webmail.freefireeventh
  • webmail.freefirehadiah-cobra2022
  • webmail.garenaff-hadiah2022real
  • webmail.gratis1922
  • webmail.grop-pemersatu
  • webmail.gruppwa-bray
  • webmail.grupvidio-viralterbaru
  • webmail.grupviralsimontok2022
  • webmail.hadiahfreefirefebruari
  • webmail.hadiahgratis-dhylanprosvp
  • webmail.hadianfreefirenew
  • webmail.indosat5g
  • webmail.joingrupdewasa11
  • webmail.joinguupmudisini
  • webmail.klaimhadiahfree
  • webmail.masuk-grupp-okepp2022
  • webmail.masuk-vidio-bokep391
  • webmail.memek-bretod-asu
  • webmail.panel-auth03
  • webmail.pizzas12
  • webmail.ratihameliaaa
  • webmail.regi0nsmember
  • webmail.reverify00useraccount77
  • webmail.rezmexid
  • webmail.secure-21dir
  • webmail.secure-auth0servftp
  • webmail.secure01zchase
  • webmail.serv-amzasisst04
  • webmail.serviceshost03
  • webmail.servsec
  • webmail.sicur-chaseonline
  • webmail.snwisks-panel-0008
  • webmail.spin-hadiah-kamu-2021
  • webmail.spincrgratis
  • webmail.subpauypal01
  • webmail.videovips63
  • webmail.websupp-oxzupf
  • webmail.werdtfyguh78-user
  • webmail.ww3-citizensverifypagehomeonline
  • wejouxhbzb
  • wesleysee
  • wggfiv1r
  • whatsapgrupmezonadewasa3021
  • whoami.dimmek
  • whoogle.alpenfestung
  • widehome
  • wiitawa
  • willeoo
  • williamst
  • wirede
  • withdrawalmycoinsx
  • wjtgwhtcyi
  • wkjisdnbjz
  • wkxwmphsfp
  • wlrvwo
  • wmweneqjsj
  • wolverfy
  • worldpixel
  • worlraro
  • wp.dolcesbone
  • wp.enander
  • wp.yongui
  • wprgirwdzl
  • wrightmic
  • wsazqkdqfa
  • wuiwreru
  • wunoh
  • wurpqswceq
  • www.94ww.git.git.mail.securchevy05b-usermanage
  • www.ab.gitlab.ename
  • www.alexlisa
  • www.analytics-staging.codashop-ff-bgid
  • www.blog.ideen-fuer-biebrich.dgit.git.wp.guai
  • www.blog.nzbhydra2.alin
  • www.claim.eventgratis-com
  • www.copyright.security-account
  • www.csy
  • www.event.claim-eventffgratis1
  • www.mail.babycipher
  • www.misterybox.gratis.freefiregratis11
  • www.nunrfsvqkg
  • www.psdschools.host12019.3ntity
  • www.s1.noresponde
  • www.superset.test.management-idusers
  • www.test.www.test.www.half4u
  • www.unimatrixzero
  • www.www.www.prod.elasticsearch.freeefirr-hadiahevent
  • www.wwwwww.csmtp.smtp.83production.elasticsearch.primo5
  • wwwsmtp.98elasticsearch-staging.securemywell-fargo
  • wwwwww.21www.redash.dev.ff-evnt-top-up-com
  • x1006
  • xakutin
  • xasa2
  • xcr4wqyt3
  • xdroq4gl
  • xdroq60v
  • xedzeqkvip
  • xepuhyuzh
  • xfilmet515
  • xfilmet7o5
  • xgwa
  • xlekxojnkn
  • xnxx-com-mom-sex.atbar28kea
  • xogggmc
  • xpxqnfbmag
  • xqutjvuggs
  • xuypizdb52
  • xuypizdhv1
  • xwdzusli
  • xwicrqjcuo
  • xwzq4s31m
  • xxvolxx1
  • xxvolzl5
  • xyatigrfcv
  • yftn.neutronblack
  • ygwqpjuwfk
  • yitayjtbfc
  • yiutlkjjii
  • yobaraavunmo
  • yonsei-grade-calculator
  • you-video-japan-dyzzfy
  • ypcgrqvvqo
  • yphlu76
  • yqunzarcjl
  • yrayhxkfrj
  • yruhrviltb
  • ytbzvfckhj
  • ythg3
  • yua
  • yusufq
  • yxzongbjwi
  • yymznvjzab
  • yysegw
  • z8ianph
  • zaydi
  • zbvesfdaxq
  • zchilpfomz
  • zdqdneziwn
  • zhqshop
  • zimbro
  • zino
  • zitxrxekrn
  • ziybrgvgsn
  • znax5xo
  • zolomon
  • zonadetreball
  • zpvnbgumea
  • zurag
  • zutcchfwas
  • zvgpotliwh
  • 10www.gitlab.ff-evnt-5-com
  • 2019.cloudilpaguro
  • 2019.lcfaria
  • 2019.mjdocserv
  • 2020.transtigen
  • 43xziyvp4
  • 5q6ri4v
  • abba-vater
  • andimandi
  • ask835
  • asyncsiken
  • autodiscover.37712296501
  • auwaigqcs
  • bamulle
  • bbo72b
  • benarda
  • bvfqtenzmm
  • cctrf4pz
  • cdcdslab-grafana
  • cduphnpuva
  • chatgpt2
  • chilasnas
  • chzlndwvpr
  • cloud.pardee42
  • conroetron
  • cpanel.adirabetholdbill1
  • cpanel.adobe-officehr
  • cpanel.emilokan6662
  • cpanel.luckyspinevent-ff2021
  • cpanel.ttyapwellz
  • cpcalendars.aleioiyuafakcacs
  • cpcalendars.citisecure5c-serveruser1b-account-auth
  • cpcalendars.officce2020
  • cpcalendars.prash-sayang
  • cpcontacts.46387388273768403
  • cpcontacts.shimaung-rhamedonks5421
  • cpcontacts.topup-gratis-6
  • cqlfsxxjnv
  • crqwvzassv
  • csadguard
  • cxleaxetub
  • degfvjmpxa
  • duihptgtvt
  • ebookuseyrg
  • ejjnrsbefb
  • erbakan
  • evolveds-7dtd-manager
  • fagpnbtaas
  • fdtmsyjjrt
  • feedbv1oa
  • foca-descargar
  • freefiregaren-spin2021
  • gd65663
  • generalpurpose
  • getfltxx
  • ghjk62jk
  • gjdvpn
  • gluccw
  • grafana.xeroxp
  • greatlakers
  • h5dny
  • hakw
  • hletpxofzk
  • home-55
  • inherent-vice
  • instance1.360ngpv1
  • ir2vz2
  • jamesilj
  • jesusabad
  • jneyjunukq
  • juda1
  • kagealready
  • kd5wbl7jz
  • kimlv2
  • kmjs
  • lauselpha
  • leeinho
  • leipzighd
  • lewistherobberyvictim
  • lgytwnmrlz
  • listronou
  • lunarlabs
  • mail.32-72469794
  • mail.account-verifiction
  • mail.amazoncardinfodddd
  • mail.claim-old-16
  • mail.ip-verifcationonlne-help
  • mail.klaimff2123
  • mail.maitsrmaizmillsia
  • mail.okeb66
  • mail.serversecurecitisignredr
  • mail.videoviralsimontok2022
  • mattv
  • minfoservc2account
  • mta-sts.airesonic-danhyal
  • mta-sts.dev.z-eus
  • mta-sts.mta-sts.cameronsucks
  • mta-sts.mta-sts.mimla
  • mta-sts.mta-sts.thepines
  • mykukvxpjr
  • nancy383y7
  • navidrome.nidito-srv
  • nkddavg1p
  • officedistrict
  • ojzjtcbcbg
  • omzndcjuyp
  • onacgyvi
  • ot73xl3hd
  • padski
  • passkyyy
  • pazxplyzrf
  • phoenixapp
  • projects.agpohzf
  • prprjvdpzdv
  • qdkxbkvhbu
  • qqrwejsjdl
  • qqxruttpkc
  • rietemahadns
  • secure6-7connect
  • separata
  • sfsecure7xb21login
  • shitpile
  • smarthometesla
  • starcity
  • stardales
  • sync.tollerpi
  • tatunext
  • tgravsha
  • thecube
  • tlbddns
  • tranrisball
  • tricuabaf
  • tsfood1
  • ullylyllxk
  • unstedil
  • unsuthi
  • vadkdmrtne
  • variex
  • vsderswycv
  • vwtvrl
  • vybxwjinhl
  • webdisk.111123305
  • webdisk.auth-navy-fcu-01
  • webdisk.claimffevent
  • webdisk.claimmlff
  • webdisk.codashopff-getnow11
  • webdisk.ff-anniversary-id-garena
  • webdisk.tgfpi
  • webmail.215544
  • webmail.37712296505
  • webmail.88234809
  • webmail.adw6a7j6
  • webmail.ffmax-terbaru976
  • webmail.uy.2100000uc
  • wjjsim2b
  • xmqnkdvkag
  • xomnvjndms
  • yoshi37
  • ypmxdeycut
  • zephyr2
  • 0343a211.cpcontacts.logigweb
  • 051bto4ep9naoon291a3jkffnw2spfsncv34l3clxx25a6oad09xiexz6n537lm.4dammikaviral
  • 0emodmwo
  • 123445fgh
  • 1532zs
  • 2020.login-microsoft0nline98765
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.x7xqnk
  • 2aigj7ym3
  • 2j2b
  • 2yxzcjr
  • 32mgit.gitlab.wzip
  • 3gdrug1
  • 404demo
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.eventfreefiregarena2021
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.fmxqpgayls
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.kasatohome
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.mgremoteha
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.microvm
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.ons-huis
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.render-haskell
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.securesecurityrestoremyappleid
  • 407e818c-086f-4a36-b2ac-bd8d354f1568.random.sobgbgyrst
  • 43290082
  • 4794516449
  • 4yyiwlkj
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.jserverdomoha
  • 5c2z8u
  • 5m4zwu0l
  • 5o3fggr
  • 61u
  • 76i2yut
  • 7vppl9eh
  • 87e6d5e3.event.itemold71
  • 8ni8nz
  • 90c0x738
  • 9rv6m4v7f8n9e0j3qexpo6i7golgn9hwdun7ta8oegt9y0p92sy40bspcxbgdan.danzinger
  • 9t5hdrw023ab4j86uxkl30hahv6ucdcqdisdl1nzpxirk2o26pvowq4s4oj3s4b.endisie
  • aaxaj
  • abdomenal.black-v
  • aczognoti
  • adenque
  • adguard.homebox99
  • aek18s
  • afwyalwrez
  • akapinteo
  • akonitan
  • aktham
  • alain-brule
  • alcatel-idol-5-firmware.saybread62ev
  • allencam
  • almstraat
  • amaramionyly
  • amyozardp
  • andres-jellyfin
  • angrybadgerdesignserver
  • angustiado
  • anonnomi
  • anuhm
  • aolzjfxaup
  • aopnqourve
  • arandaftp
  • archlinux-install-drivers.innat72en
  • arcsine
  • arehen
  • asibah4
  • asixblai
  • ast0060
  • ateruya
  • athsaytltu
  • atilis
  • auth.dfh8u586ujlcms58un9i
  • auth.tuivpn
  • autodiscover.813243695308
  • autodiscover.96876562205
  • avat
  • avifilmop6s
  • avifilmovan
  • avmylqunhh
  • avo9bmv9tnlo
  • avqlfbwiln
  • avzprswply
  • ayksdv
  • baconsult
  • bahncuter
  • baja
  • bal.rhcc
  • bapakaj
  • baskaplex
  • bdiuyok
  • beez2
  • bejijabpqk
  • besameymucho
  • beytoo
  • bfvaeidiju
  • bgpyjxqvla
  • bhqsxzechd
  • bibliopdhen
  • bibliopdr1v
  • bibliopdr9y
  • bibliopdwhd
  • bifax
  • bitwarden.netwerks
  • bixio
  • bjsmarthome
  • blueboy
  • blxerajorm
  • booterbotscan
  • brooksmedia
  • bsoolhre
  • buchsi
  • bunnizx
  • burafili
  • burwaper
  • buwuimqe
  • bvfpdscevq
  • bvpcmhmofe
  • bwbh
  • bwvsgrpszp
  • byshop
  • bzamyk
  • ca001
  • caytrungga
  • cazcoveleda
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.5mf5yff
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.bettergoogle
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.boke
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.btapitchousg
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.fassbinder
  • cbd2912e-d4ea-4c3b-8b4c-87b949344771.random.naything
  • cblwphny
  • cdsmith
  • cdxtujftww
  • ceracri
  • cesurnet
  • cfnews
  • chanitomedia
  • chibesa
  • chodashop-graris-777
  • chondreli
  • chromocollograph
  • ckhw9qf
  • claim-hadiah-gratis205
  • claim-itemffnew
  • clor11
  • codashop-gratis-allgame2021
  • commissively
  • commonsensically.duckdns.orgcommonsensically
  • computar-taciana
  • copselane
  • coronovac
  • cosplay-x-lucia-love.bridot28troub
  • cpanel.52435732243
  • cpanel.bcrmnbkghh
  • cpanel.bokepviral18-whasappgrup
  • cpanel.bokepviralgrupwhatsap
  • cpanel.cek-auto-ress-2022
  • cpanel.citizens-user4
  • cpanel.claim-chip-free-21
  • cpanel.claim-ff-gratis-1
  • cpanel.claimm-ff2022newgratis
  • cpanel.codashop-bug-free13
  • cpanel.codashop-freefiree864
  • cpanel.codashop-xgratis4
  • cpanel.codashopp-ff-gratiss2021
  • cpanel.crbuknako
  • cpanel.event-freefire183
  • cpanel.event-gratis726
  • cpanel.event5.claim-freefirez09
  • cpanel.eventgarenanew2k21
  • cpanel.ffevent2021-xyz
  • cpanel.ffgamebaba
  • cpanel.freefiregratis
  • cpanel.hongtrantrendoicanhtay
  • cpanel.khgma448fa
  • cpanel.locomotivedesk
  • cpanel.luckyspinff123
  • cpanel.masuk-xxhotchat
  • cpanel.mobilelegend-event181
  • cpanel.newviral
  • cpanel.paybillingap
  • cpanel.percobaanyangkeseratusduapuluh
  • cpanel.slov-alnavobanskid1993001
  • cpanel.spinbundel-freefirev11
  • cpanel.support-account1-page
  • cpanel.tampcodal
  • cpanel.terbaru-event-freefire22
  • cpanel.thsu2
  • cpanel.twtziskd
  • cpanel.vip-freefire001
  • cpanel.whatsappgrupviral688.videohotviral56
  • cpcalendars.222292
  • cpcalendars.7898964508
  • cpcalendars.8889585689617
  • cpcalendars.allupdetishere
  • cpcalendars.ambil-luckyroyal-geratis10
  • cpcalendars.c-coodashopp-geratiss
  • cpcalendars.citizenszelle
  • cpcalendars.claimff-luckygratis
  • cpcalendars.claimffws-realgarena2021
  • cpcalendars.claims.garena-eventramadhan
  • cpcalendars.daymercy-x11
  • cpcalendars.diamond-gratis-2021-garenaff
  • cpcalendars.diamond-gratis-real21
  • cpcalendars.event-mobile-legends-a6
  • cpcalendars.freefiremaxspingratis
  • cpcalendars.garena-claim-item-old-disini
  • cpcalendars.grubokep-2022-terbaru
  • cpcalendars.grup.grup-resahh
  • cpcalendars.klik-bundel-ff-gratis33
  • cpcalendars.masuk-grubbokepsma
  • cpcalendars.masukgrupdylan-0
  • cpcalendars.mttb345
  • cpcalendars.new-inforeall92
  • cpcalendars.nnnewwwgruppp
  • cpcalendars.notice-citzn01
  • cpcalendars.secudna
  • cpcalendars.secure-07c-verification-online
  • cpcalendars.servpage-amz012
  • cpcalendars.sup-orting-inalich1929310
  • cpcalendars.wellsbank23updat273
  • cpcalendars.whatsappgrubbterbaruh
  • cpcalendars.xepoml-19sad
  • cpcontacts.85462059
  • cpcontacts.becuhelper1-home
  • cpcontacts.berbagii
  • cpcontacts.chat-grup-viralindo-s3x
  • cpcontacts.claimeventgarenafreefie2021
  • cpcontacts.claimgratis1
  • cpcontacts.claimneweventxyz
  • cpcontacts.claimskinneweventgv
  • cpcontacts.cloudteamdelivery
  • cpcontacts.codashopgarena
  • cpcontacts.confirmmypage1000325987100
  • cpcontacts.cuangwcok
  • cpcontacts.event-gratis-ff71
  • cpcontacts.event.terbaru981ter
  • cpcontacts.eventskingratis-freefire
  • cpcontacts.evnt-garena27
  • cpcontacts.freefiregarena-123
  • cpcontacts.freeskinmlbb515
  • cpcontacts.hanyakamoehdh4rfs
  • cpcontacts.higgsdomino91
  • cpcontacts.idamazonaccount
  • cpcontacts.invittgrupwattsap
  • cpcontacts.lyxcus
  • cpcontacts.mlbb-event-mly
  • cpcontacts.net7uverify
  • cpcontacts.nsecurewells
  • cpcontacts.redartsmtp
  • cpcontacts.rewardsboa
  • cpcontacts.sec-citizens
  • cpcontacts.secure03arvest
  • cpcontacts.securecitizensconnect
  • cpcontacts.serc-05mtb
  • cpcontacts.shortlink1xchase
  • cpcontacts.spin-crate
  • cpcontacts.tribun-2022
  • cpcontacts.vidio-viral-smtk1
  • cpcontacts.viral-vid-pingbanget71
  • cpcontacts.viralvidiorohmancrot
  • cpcontacts.web-demo-lacos
  • cqcrpauczh
  • cripcrib
  • crypto101
  • culpfofi
  • cwclkmqzot
  • d3rkfire
  • d4m2
  • dacoqxlkkx
  • danigay
  • dannyshields
  • dansplex
  • dantelemorelos
  • darcometemin
  • datei.muellerserver
  • davinchi
  • dcinemb5k0
  • ddesgcj
  • deeneeseprotoniana
  • deenenha
  • defence
  • delcqukdzy
  • dernaros
  • descargar-driver-de-sonido-para-windows-xp-professional-gratis.rebse34thron
  • deutchbuci355
  • diastrist
  • didihome
  • dlibnsr
  • dlibnt8
  • dlyl-ltswq-br-lntrnt.mhtm-lkthyr-mn-lml-s-whd.8-trq-hll-lstthmr-mwlk-fy-msr-yjy-brs.fdl-18-tryq-lksb-lml-mn-lntrnt-steem.s-r-thqb-lmthr-lydwy-fy-bkstn.shy-tsmh-lfndq-bsthbh-thn-lmgdr.km-tklf-trkhys-t-dyn-ldhhb-fy-ljzyr.mjnan-tlyf-jwn.www89
  • dneoyacqtn
  • docomoqwkb
  • dolguldur
  • doloresgallardo
  • domeniu1
  • dorcas2udownload
  • dowling
  • doxoyra
  • dragon93
  • driggs81
  • drusilla
  • dtbab2qt
  • dushpatel
  • dvfurykadek.j2fspardal
  • dvmaster-depa
  • dxjraabera
  • dyovhhngyd
  • dzivoklis
  • ea2
  • eaoui4zfv30m0jaciqyvq6mq5o1jwyoi0xeno4thi92nr2ai05snyskmwgpzy4a.spinbandhel5
  • ebooks333
  • ebooks36r
  • ebookusey7q
  • ecpcloud
  • edyozhglhm
  • egate.amdconnect
  • ehremati
  • eillwekquv
  • ejalsltqxm
  • ekfqucvltn
  • elephantizer1
  • elshani
  • emesar
  • emgrobesnas
  • eossshxigq
  • epubty43
  • eracab
  • eranavidor
  • ericjacques
  • esiazjfwif
  • even-coda-shop-gratis-2021
  • evenspok
  • eventgarena68
  • eventspinold
  • evnt-moonton-free99
  • exfhxjixek
  • exhnekvtgz
  • f8475
  • fajlzjdfph
  • farida
  • faststore131
  • favqlysnmb
  • faxeq
  • fbwqlgbnnj
  • fcnt
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.edocss-mandting
  • fdagacsqge
  • fddfe
  • feassarian
  • feedbuwqh
  • feedbv6f2
  • fenopmi
  • ff-garenaeventnew-2021
  • ffdtyfiyci
  • fidcawuunp
  • fiif5
  • filadelfia-md
  • filritet
  • firstnigeria
  • fjantus
  • fkjw3741
  • fmkavtma
  • fmxinycjpw
  • fnykydd
  • fortnbooktkf
  • fortnbookzjy
  • fortnbool3g2
  • fortnbool6nv
  • frankfurt1
  • fraunha
  • freshrss.pawp
  • friendlyocean650
  • frisbeevpn
  • fsdhgghj
  • ftp.hdtoday
  • fuashoa
  • fwp85alw0
  • galice
  • galingale
  • gdherzycyw
  • getflo9b
  • ggqpwquslj
  • ggrthfoflw
  • gim7
  • git.git.git.git.eastus.metadata.azure.comr.sts.detmer
  • git.git.git.git.gitlab.artflorem.comhi.kreds.detmer
  • git.git.git.old.dedaza
  • git.gitlab.git.melissapottker.com.co.sts.detmer
  • git.gitlab.gitlab.git.git.git.git.comitets.detmer
  • git.starinit.gafr.sts.detmer
  • gitlab.git.git.gitlab.lacolectacreamas.pe.fr.sts.detmer
  • giveaway.letda
  • gjbr5-wol
  • gjdtqzpgtn
  • glomon
  • gluccapneu
  • gmpofwrvrw
  • gob-be
  • gohhmkjrfk
  • goinghomenow
  • goloh
  • gravapma
  • group.panda-nomada
  • gunamerican
  • gutmann
  • h750ix
  • ha-machern
  • haarr
  • haepic
  • hajderp-local
  • hakimhadns
  • harotoro
  • hassaway
  • hazey-reddit-dump.provas64gren
  • hdiptv
  • hentjajqdn
  • hjemmekark
  • hjxejdmawg
  • hkpob75
  • hlaqnb
  • hlfofshkbo
  • hmqzyytxqc
  • hmscl
  • hog
  • homeassistant.majahouse
  • homeassistant2901
  • homeassistantgeetbets
  • homedelvalle
  • homemariusz
  • homesito
  • homethegrid
  • hotpromo
  • hs12
  • huddyshome
  • hxhuwylwhp
  • hzdhds4u
  • iboost
  • icaklhegiw
  • ichneumonized
  • id9vze34xgcl7ku9.verify-onlineuser
  • idapleurifmeb73irye
  • iejrdsagqd
  • igetmoney
  • ihtyiexqxg
  • iinfo53
  • ik7i8k78i4k54h65gfh6fg
  • iljajhoyak
  • inesferragudznk
  • infoo1070
  • inwall
  • ir5ff5trxpy86e94
  • isamit
  • ixeduk
  • izgkucanzu
  • izowaefksf
  • j4e6mo4cr
  • jallyjdpro
  • james-beard
  • japan-you-tubes-kwtzxw
  • jaqgvtrkgl
  • jaroju
  • jawjkxbwko
  • jbcjsr
  • jcbertocchi
  • jdevega
  • jdytgavpul
  • jean-bfcn
  • jellyfin-zks
  • jellyfin.scskoki
  • jellyseerr.mrren
  • jetmaste
  • jfjandmxib
  • jfrwepgmtd
  • jgarcia
  • jivaw5
  • jjclar4
  • jlsqdhrxly
  • jniyfzgprx
  • joatse
  • join-grub-whatsap-vidio-viral-new54
  • join-grup-wa-bokep-sma
  • join-grup-wa21
  • joingrupbokep82
  • jrmcaxvvxv
  • jsato26
  • jsmcbrxiev
  • juanmaerdios
  • julien-homeserver
  • jyj
  • kayaflixspeedtest
  • kdxecnohmg
  • kecotha
  • keeapmhdol
  • keeep9sw9
  • kehagcukw
  • keluaer
  • keluar
  • kerbeross-syno
  • kichlela
  • kiodtes43
  • kjaerspliid
  • kjiudbw3v
  • kjiudby2k
  • kkihfz1r
  • kkihg0aa
  • kkihgd9i
  • kleinod
  • knhsqngzph
  • kolomeets
  • korek
  • kroken10
  • ksnwbtshcr
  • ktrmppxiljaqd.surgepark
  • kumpulangrubviral
  • kway-mart-na10
  • kxmgxwfzuu
  • kxmqoxrmiu
  • kyatec
  • kyledhardison
  • ladsr
  • lasmasputotas
  • lasxdh5
  • laz-patreon.viemo61mett
  • lcbermudez
  • lciddl
  • lewypasnas
  • libaboomy2
  • libricupud
  • libricurxo
  • libricv4ck
  • libricv58y
  • lidarr.jm2003uk
  • lifiecgi
  • lingraho
  • lir
  • lisarb5149z
  • ljbbrspgro
  • llevidwi
  • lloyd-metroplex
  • localmhlnstdt
  • login-microsftonline-com
  • lpckttncli
  • lunarlore
  • lusnoop
  • luutranit
  • m.evilmixnow
  • macroscelides
  • macweriu
  • mad-moxxi
  • maiback85grab
  • mail.0321635463511
  • mail.48426731716
  • mail.abg.joingrupbkp769
  • mail.ciabsja
  • mail.claim-item-freefire111
  • mail.clmevntgg
  • mail.codafref
  • mail.codashop-gratis-spesial222
  • mail.codashop201
  • mail.dyed34d
  • mail.eventt.free-fire-ori-dan-max
  • mail.ffver
  • mail.fixiijkhkhiyy
  • mail.free-fire--ev0
  • mail.freeclaim-ffevent
  • mail.freefirekuiy
  • mail.helpcheck
  • mail.item-oldfreefire10
  • mail.luckycrateffid
  • mail.maulahhijau67854-paymnetcstmr
  • mail.msi36cmiecoffice
  • mail.my-mfcu1st1
  • mail.newgrup-whatsapp
  • mail.secure-verify101
  • mail.sign-xfinityaccountupdatev0jdohw
  • mail.situr-bokep18
  • mail.tebar-zexfalxrans
  • marcosgay
  • mattsaka
  • maxcono
  • maximagsm
  • maxven
  • maymortne
  • mazinoserver
  • mbvkqfpvne
  • mc02mus4wc7emjl72t5g
  • mcplays
  • meera
  • mein-weltbild
  • mipeleozen
  • mlbbfreeskinnewvc
  • mlbbpo
  • mlltelvtoe
  • mnbayxmjtl
  • moaz7assan
  • modesmenu
  • mole0815
  • mondotosz
  • monophagous
  • moonrod1
  • morsadic
  • mp260
  • mp89
  • mpqowgkfhe
  • mta-sts.cesariello
  • mta-sts.commitnz
  • mta-sts.cpanel.lucille
  • mta-sts.crazymonkhome
  • mta-sts.ctuot
  • mta-sts.custana
  • mta-sts.fghfdhgdf
  • mta-sts.gwbonx
  • mta-sts.klaim-skin
  • mta-sts.leofuscaldi
  • mta-sts.mad-hat
  • mta-sts.mta-sts.axelmonitor
  • mta-sts.mta-sts.bidiboule
  • mta-sts.mta-sts.bigtearice
  • mta-sts.mta-sts.datpurple
  • mta-sts.mta-sts.delasonsierra
  • mta-sts.mta-sts.domshome
  • mta-sts.mta-sts.fourot
  • mta-sts.mta-sts.mta-sts.guro
  • mta-sts.mta-sts.nixsm
  • mta-sts.mta-sts.owenmorley
  • mta-sts.mta-sts.we3
  • mta-sts.nozero
  • mta-sts.robohomoman
  • mta-sts.rutuparna
  • mta-sts.thechapmanhome
  • mta-sts.tweenways
  • mta-sts.wanschzone
  • mta-sts.webmail.contigga
  • mta-sts.webmail.visitall
  • mta-sts.woodstockmorrison
  • mta-sts.www.theia
  • mtnsa
  • mtsecurevb2bank
  • muesli-s240404-portainer
  • mussserver
  • mwdfckyklw
  • mwriigqqqc
  • mxgjetgxoh
  • myeworvi
  • mynass
  • na7kr
  • nadzlydv
  • naomitang
  • nasrivera
  • navidrome-rafael503
  • net-service
  • netrime
  • newnutrients
  • next.tbirda
  • nextleo
  • ngpuaumhbg
  • nmhwnxjccz
  • nmpl
  • nodered.timvancann
  • nondbarm51rei
  • nonunanimous
  • noporse
  • normoxic
  • norrapo
  • ntwrjcwcva
  • number251
  • nutomx
  • ofbahar
  • ofd-sftp
  • ogrep
  • okshop
  • omv5media
  • onanurxdnsbg862i.akayush
  • onlinefilmetma
  • organizr.plex-008
  • osunwoo
  • owenkrueger-homeassistant
  • oyruilwnan
  • pascalis
  • pat1980
  • patreon-com-jennatrap.quayter26man
  • patreon-wayaway.pursi65tip
  • pd2pecdel
  • pedroalmeida1977
  • pemacas
  • perpapo
  • peter1983
  • pggpzfywac
  • pgoanodnkq
  • pgrd1j7gp
  • pgse
  • phdquality
  • philly69
  • phyacrwrqk
  • pihub
  • pkdev
  • plcdtuuggp
  • ple.evien
  • plex.balkehome
  • plex.blegbox
  • plexviper
  • pmpcloud
  • pmsdqkcfcw
  • pnmatias
  • portablfkl
  • portainer.alfred42
  • portainer.schmyddy
  • powerline
  • pqos
  • praxislasrozas
  • prdpiguuln
  • preobligation
  • prjuzcpxlw
  • proyectoz
  • ptichka
  • pvoilphumy
  • pvubkicfrew.juliox833
  • pwxgvohbic
  • pycnogonida
  • qaquzjer
  • qaxc
  • qbzzt-relay
  • qcrshsvsfe
  • qdaxjzdeji
  • qdeejpuawl
  • qikhzcpanel.back9
  • qmwrgapvde
  • qpdfmjffjt
  • qprwivhhuu
  • qsnk5v3sb
  • quxusetycm
  • qwgjciyjyt
  • qytkgbjqyt
  • r18zte
  • r6zj0
  • rabab
  • rambit
  • ratao321
  • rcha604
  • rdcdxklrus
  • reevire
  • rekrico
  • requestrr.jakeflix1
  • rerorehan
  • rewardpubgmc1s1
  • rft54
  • rialta
  • riarova
  • ricsxn
  • rilunti
  • riolisi
  • rismurkhoj
  • rjiktpgafb
  • rm-finsec-authtoken09c11
  • rmklcsoidf
  • rngxflxwyi
  • roachii
  • rockstar
  • ronaldbeukema
  • rooneyhome
  • rozenfontein
  • rpntest
  • rrhfsb
  • ruilota
  • rust-zona24
  • rvrouneepq
  • ryu9ai
  • s16-vault
  • s3cur3us3r-inf0us3r
  • s3rver.lea3d
  • sabershia
  • sangfish
  • saucepal
  • sbvu4av5
  • scp1testrun
  • secu21-my-help
  • securce35c-office365-live-xn-cae-oed5j
  • securefchaccn01
  • securityde
  • seeweed
  • sefserver
  • sendylnhyp
  • sentrera
  • serv2cntcomsur
  • servidordani
  • sfilkingmen
  • sharonheb
  • shatteredvoid
  • shop.enelgreenpower.preprod
  • shop.smjjang
  • shtheeev
  • simon999
  • simplyenglish
  • sip.warhomelab
  • sip.zglxauight
  • sirflico
  • skytoyoung
  • slowski
  • smartant
  • smartdom2008
  • smjkps2
  • sndqknkcwx
  • spain-nimweb
  • spesatli
  • spynetruckler
  • ss0-g0dady-c0m-25-2
  • ssuckss
  • standela
  • starines
  • starmortti
  • stella-chuu-reddit-patreon.tighge58me
  • storm-webdav
  • strasech
  • strasglo
  • stratfordst
  • stung
  • suitodestpacdo
  • sukin
  • sungpitpa
  • support-amazon-verifycardissuer-page
  • swantitu
  • sws
  • sybhqutlfi
  • syonxdrpua
  • syxloslbjw
  • t0kq7em1
  • t5ozvtpkjklh4qmtnwkjpfnqym87s11q9xt4as6gdyz0wuvuhxpwte73h2ua6h7.codashopbagibagidiamondfreefire
  • t68zkmx0t
  • tairemon
  • takg
  • tasmo.anasral
  • tatcenter
  • tauwnnvelu
  • telka21fred
  • tesssesceee
  • tgrsfresrw
  • the-groots
  • therodox
  • thomastest
  • tiesnabbob
  • tjfzboksgy
  • tjldsl
  • tjythxuvha
  • tmovif2t9
  • tnhgd
  • tnsdcyoeeu
  • tonidg-prova
  • tonysala
  • toreador.red-v
  • torsgard
  • towers
  • tozo1
  • tpci
  • tqorjyffyv
  • transmission-docker.c0eos
  • transmission.mchotfoot
  • travel39928
  • travel5487
  • travel62348
  • trophsene
  • truckee
  • truid-ff-notcurl
  • trusanov
  • try-catch
  • tsujintrepabfu
  • tsyn9328j
  • tucnet
  • tufan
  • tverlandetil
  • twilight-suzuka
  • twls63xj
  • tynajor
  • uacbipass
  • udoraio
  • uezekg
  • uhfikwimms
  • umgwdgxsmg
  • unhutched
  • unraid-vincent
  • unvalued0844
  • uplifts
  • urkczrykhy
  • uros
  • urunehgric
  • uuaccountservic3
  • uyinhq
  • uzuuvxzply
  • vdbkhefbxj
  • vdsm6h
  • verify-truist
  • versnoga
  • vhr2n5ie
  • vibe2020
  • videohot00078
  • vinogradovd
  • viralhackss
  • vkqeoyavjl
  • vmjuidiaz
  • vmpx
  • vmtjgkplck
  • volokzhanin
  • vronny
  • vsp7jb
  • vuhuflic
  • vutruonghainam
  • vvalihb2
  • w1-xtxrnl
  • wall3
  • wayfihack
  • wdoyjelbtj
  • wdyhwmjlow
  • webdisk.208020975801
  • webdisk.23454295
  • webdisk.3698745253
  • webdisk.50perday
  • webdisk.536376507
  • webdisk.amazon-signin-871jum44t1-184
  • webdisk.amzasisst1-service4
  • webdisk.authentification-mobile
  • webdisk.bofaprepaidproveddalertspsr
  • webdisk.chat-grupviral2022
  • webdisk.claimevent-ffofficial
  • webdisk.codashp-ff66-com
  • webdisk.collabfreefire
  • webdisk.crate-bundle-cobra
  • webdisk.deskhelper-amz3
  • webdisk.event-codahsop-gratis
  • webdisk.event-sepin-ff-18a
  • webdisk.eventclaimsgarenafreefire999
  • webdisk.eventcodashop88
  • webdisk.eventtopupgratis-17k
  • webdisk.frer-fire
  • webdisk.grup-viral-2023
  • webdisk.joingrup-virall18
  • webdisk.mek1-lamazon
  • webdisk.newcodashop-freex2
  • webdisk.oviewmyaccountinfoo000
  • webdisk.petingtehpoek
  • webdisk.portal-card
  • webdisk.secure-account
  • webdisk.secure0achase
  • webdisk.secure76-c1t1us3r
  • webdisk.securemeback-5228
  • webdisk.securemeonline
  • webdisk.servpagemail10
  • webdisk.telegram-chvideos
  • webdisk.tester33
  • webdisk.testspqunasjdlgowuwjq
  • webdisk.verifywf
  • webdisk.whell-spin-ff
  • webmail.646766705
  • webmail.anrogacor89769-politikgfhgf
  • webmail.chatgrubwhatsap2021
  • webmail.citizensverifyonline
  • webmail.claim-item-gratis545
  • webmail.cobrabundle-event-free
  • webmail.coklatt00.event-gratis-freefire-resmigarena
  • webmail.diamondff-v001
  • webmail.dmff-free-2022-event-terbaru
  • webmail.even-ml-356
  • webmail.event-ff-gratis-garena123
  • webmail.event-free-fire-garena-2021-november
  • webmail.event-hadiah-free-fire
  • webmail.eventblodraventgeratis
  • webmail.filmpendek18
  • webmail.free-hadiah2022
  • webmail.free.claimgaiss-mumpungpromo2021
  • webmail.grupwhatsap79
  • webmail.hadiah-mlbb
  • webmail.hghgfghfhgffff
  • webmail.indo-viral
  • webmail.joingrubbokep-whatsapp20
  • webmail.l2sacamuu
  • webmail.mesaggi
  • webmail.mlbbgratisspinn1
  • webmail.mobilelegends7777
  • webmail.pubgmobile-free
  • webmail.qlamff
  • webmail.simontok-new-virall-18
  • webmail.simontokviral-id16
  • webmail.skinfungarena.ddesljt
  • webmail.sodakoh2256
  • webmail.spingratisdarigarenaff
  • webmail.svrrerrsharepointonline-bb1b-ab3789ee6af
  • webmail.test-script-2022
  • webmail.topup-gratis-2022-real-chodashop1
  • webmail.trueid-ff-xyz
  • webmail.user-pplginyu
  • webmail.verify-mtbnking-auth10
  • webmail.viralnew-2021
  • webmail.wellsduc
  • wegwaxhoferha
  • weriklore
  • wg-ga
  • wg.jnvernve
  • wg.mathsyncdpi
  • wgodkwidux
  • whm.claim-item-diamond-gratis-sini
  • whmmini
  • wkgxdiowhd
  • wkhmpluztb
  • wmf-grafana.retrodaredevil
  • woatnzyiby
  • wogmfhygku
  • wolfvx
  • wordpress.torgny
  • wordpress.vedskjulet
  • wordpress21
  • wp.myhassq
  • wrqbxkbymg
  • www.eventspin-2021.subdomain2021
  • www.idvspnjflc
  • www.imap.65gitlab.gitlab.mail.securemywell-fargo
  • www.noderedpopus.supercukiwifi
  • www.s.hadiahfree
  • www.www.www.5www.prod.elasticsearch.management-idusers
  • www.ymteznza4njm3
  • www.zayaoso
  • xaec
  • xffw
  • xfnw
  • xilb
  • xodumtuw
  • xono
  • xpgsqamldt
  • xpuqmjfbts
  • xukirae
  • xw5ziaj
  • xxkkoreqee
  • xz6ngidw
  • yarrbox
  • yhmdp
  • yhu4e5t23w4532w325rr34
  • ykcahrjywx
  • youknowwho8782
  • yrrjmfojgq
  • yszcowwnqf
  • yt6
  • ywebjjqaui
  • zaabtdbzef
  • zaforas-ha
  • zbvezskwxc
  • zewlxxbb
  • zkjizayxkb
  • zkuowygfts
  • zpcilw0j2
  • zwpgpy
  • zzurxtyaov
  • zzzbyj
  • 000245842029
  • 00024731212
  • 00054894063
  • 00091692661
  • 000965432
  • 001113225
  • 00197703348
  • 0055120136503
  • 0056332
  • 0056339
  • 00r9b4k8r
  • 00z2d
  • 011249547
  • 011249565
  • 01deepfact1214
  • 01flutxx1206
  • 01monkeyx1213
  • 01spacefla1236
  • 01worldfla1241
  • 032165010
  • 032541014
  • 032541015
  • 03982
  • 0424200382tclb
  • 043p
  • 054743434818
  • 065656777756612
  • 06azi5fwcnlr56sofkso
  • 0808587050
  • 0993441481
  • 0bits
  • 0edeqto7
  • 0o2p8oubt
  • 0oa968p
  • 0p33br90c
  • 0qzywr43.fesde
  • 0syqaxd
  • 0y3
  • 0zvg4obqku493s8x.vinceson
  • 1000234983907
  • 1000234983915
  • 1000harrywgvpn
  • 10032041510
  • 10051881908
  • 100556852920
  • 100810416218
  • 101026539517
  • 1011134984556
  • 1011134985009
  • 101329411916
  • 1014798508
  • 101582521515
  • 101600919309
  • 101925132914
  • 102075811813
  • 102113152109
  • 102223624
  • 102283115409
  • 102404724808
  • 102613128403
  • 10268774508
  • 1027875611
  • 102788361605
  • 103151861815
  • 103411224806
  • 103546648705
  • 103549211404
  • 103711788801
  • 103728582410
  • 103879455408
  • 103975599104
  • 104200298303
  • 104348351412
  • 104380254603
  • 104650518509
  • 10469082416
  • 104799491407
  • 104869188717
  • 10493603111
  • 105091492514
  • 105140834701
  • 10532131205
  • 105345232501
  • 105467002413
  • 10561765920
  • 105635382215
  • 10567530106
  • 10605393520
  • 1067538311
  • 106767185503
  • 107097795505
  • 107097795514
  • 107114532207
  • 107404691904
  • 107543488914
  • 107573302616
  • 10813686115
  • 108153715303
  • 108433768701
  • 108512701119
  • 10853915809
  • 108788953807
  • 108789980401
  • 108864218702
  • 10898456119
  • 10947350508
  • 10947350510
  • 109929137509
  • 109978425420
  • 11016818518
  • 110237761611
  • 110899731708
  • 110910881210
  • 110910881218
  • 111064391806
  • 11132113
  • 111953421502
  • 112190278511
  • 11221335480
  • 11302254118
  • 113168621815
  • 113234943704
  • 113462782607
  • 11364325
  • 113814761219
  • 114772994807
  • 115053448212
  • 115091978206
  • 115236494
  • 115673283879
  • 115835441714
  • 1165443
  • 11661245119
  • 117263258516
  • 119476791112
  • 119835
  • 119969091307
  • 119969091318
  • 12031693702
  • 120316937611
  • 1230hass
  • 12322354207
  • 123vivalagerie
  • 12448984304
  • 1263711458
  • 128894473804
  • 13082798106
  • 133265478903
  • 134066180404044
  • 1364
  • 14094802807
  • 144076010618
  • 1478965403
  • 147lanaway
  • 148956577407
  • 15082004
  • 1535151
  • 154551218558
  • 154551219077
  • 154551219461
  • 154551219491
  • 154551219548
  • 154551220099
  • 154551220222
  • 154551220247
  • 1550
  • 155534964804
  • 156639525112
  • 157346582452
  • 15743387404
  • 159410223420
  • 16728946303
  • 169477444705
  • 1709689412
  • 171404633307
  • 1750987407
  • 17863470
  • 17918729215
  • 1820
  • 18281041110
  • 185967868111
  • 190200813907
  • 19426035708
  • 198598480208
  • 1c2jrj
  • 1dtac
  • 1e168sf
  • 1fv8o
  • 1m1wzv-000707-b1
  • 1m2599-0004jw-on
  • 1m3i5q-0000a9-i2
  • 1mudau-0002rg-vh
  • 1nmf997
  • 1oh1-local
  • 1vim
  • 1w8ix198bu9lqee
  • 1ztro9
  • 200034257363521
  • 20071929
  • 2019.cicd-javaloom
  • 2019.prasadunraid
  • 2019.toembed
  • 2020.ancodia
  • 2020.filoni
  • 2020.giamalo48
  • 2020.jitsi-lab
  • 2020.robertobinetti70
  • 2020.wietek
  • 2022-12-17znegeulfluxsisilafamille.firezone01
  • 2022154006
  • 20233
  • 202436i
  • 20299357
  • 207296629712
  • 209910234
  • 210567310
  • 21415546
  • 21651613207
  • 22009978715
  • 222061297665719195483120436571215602917
  • 22220147808
  • 22445620717
  • 225134632
  • 22qx2tp7
  • 23532334364
  • 23669857407
  • 23908262819
  • 239108757413
  • 23n5g0xy56yz
  • 24-days
  • 242465719
  • 242510001
  • 245328658911
  • 24wz
  • 250725209804
  • 25241490408
  • 2544645465618
  • 25466491315
  • 265080260611
  • 266934513417
  • 26l09eb
  • 27308258913
  • 276589806
  • 281157789316
  • 2828282811
  • 283a474c-08dc-4108-be72-e4c8a9ec7e49.random.cuchos-cuba
  • 2889721664
  • 289894446610
  • 2b3weo
  • 2iz6
  • 2n4q6vjut9f7hami.std.dlajarvis
  • 2qnpab
  • 2rk3z.d6b8dyl
  • 2tfmii3bgj3397
  • 2ttvbb4r
  • 2u52ne
  • 2vwqitzhn
  • 3-francois-bordeaux
  • 3-rheda.duckdns.org3-rheda
  • 304
  • 30812586310
  • 30a93cdb-762a-4bab-88bb-2d03a5fc5a46.random.stanniesnc
  • 310454127502
  • 31ec-4b00
  • 31nevern
  • 3214662513
  • 32578756877823
  • 33309223
  • 333262520
  • 342343421444
  • 3424242409
  • 345433513
  • 348ha
  • 370samantha
  • 3752sozt
  • 38287149105
  • 38ruyp
  • 39939058706
  • 39s3ry4
  • 3aityj0y
  • 3ggrob0t
  • 3jrug7s
  • 3kx26r7t
  • 3mbxpnt6
  • 3npyh1
  • 3oxqztt
  • 3www.elasticsearch-dev.event-pubg3rd
  • 4-837185464
  • 40170707918
  • 4031
  • 405ns
  • 412578314
  • 4215trj
  • 42500003488
  • 4268318117
  • 432151114
  • 432667989451
  • 432667989453
  • 4343567658
  • 43543534312
  • 43899911
  • 43homeassistant
  • 440988132608
  • 44323243
  • 4444324568715
  • 44445236812216288
  • 44safehouse
  • 4534407
  • 45423401383
  • 45423401630
  • 454444903
  • 4564465612
  • 45657902
  • 45678905
  • 45777704
  • 458760030
  • 46234
  • 4657767614
  • 46746265754310
  • 4754789533228
  • 4877979853603
  • 48gr5i
  • 494211560916
  • 4fh0m34551ffjitrqq
  • 4iyx2bw
  • 4kjaippbm
  • 4thclk
  • 503840026413
  • 50425134104
  • 513268788703
  • 515154308
  • 522197131a.widevine
  • 523524d0-pt1636770544.cophiko
  • 535475874610
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.amzon-signin-8194mrvls273
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.meitek
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.ocblubzdmj
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.secure53rdbankacc
  • 53e2e72e-92ec-45bd-b5bf-5230e35c1564.random.triayaamserver
  • 53online-support6
  • 5435463610
  • 5435463617
  • 5464563404
  • 54654656456
  • 5498231413
  • 5505wallace
  • 55210814
  • 554081868916
  • 55534618866280
  • 55552145269504
  • 561562315601
  • 5634749802
  • 5698745626409
  • 569999793112
  • 5784
  • 5787976305
  • 594563254
  • 5gibbs
  • 5j165akjj
  • 5lpod8gkey4159
  • 5nv3uo
  • 5sbje97a9
  • 5tcocy
  • 5tr7aha
  • 5trb14y2r5by14r5yy4r1b1y
  • 5u451qvd
  • 6025498799714
  • 60291503420
  • 6090dfb65c98authdp
  • 6287
  • 63271
  • 64650574506
  • 6468524253
  • 648372513
  • 65165462
  • 65181
  • 65333987412608
  • 655666637
  • 65738329929719
  • 657502
  • 666738
  • 66679889702
  • 6668524566610
  • 68752385616
  • 69home
  • 6a1f91cd.habazini
  • 6b9vhc
  • 6da
  • 6h2uyn72
  • 6je4
  • 6lowelldr
  • 6n91n8wa7
  • 6nkdb0
  • 6ojh3h
  • 6ox9lfl80f493p5snbypb3yhgpc1rf4j2wz14u55eew8d3g2hqk2e9b3dvs4kgf.membershiprenewal-amzconfirmation8sh
  • 6p08dayslv3mu9n7q5
  • 6swyan
  • 6uyw30
  • 6wc8xuvht
  • 70010020001179929
  • 70011811331189910
  • 70011888958589906
  • 70441692301
  • 70690326
  • 71ncy0gui
  • 735289663117
  • 7380065
  • 749hmqmobnpdi42b.superset.vsppolvaij
  • 7564553245
  • 75wllih
  • 76430965301
  • 7650production.airflow.freefire-even
  • 765734211529
  • 77778585659510
  • 77865316
  • 781811
  • 787ash
  • 789644103268706
  • 78986554710
  • 7899187252412709
  • 7998765434563706
  • 79qo7yzh
  • 79znqleayu43vinppbygs4p8p5k8l0sslix2oqloy1v95yzmttxycaoz4wzl8o6.chasebankt
  • 7hiqxuly
  • 7jfvwed
  • 7q8r98zv
  • 7qgker8
  • 7tm
  • 800002584456688611
  • 800011313300688619
  • 800025369583600
  • 800033919548902
  • 8071334614
  • 80818285
  • 8110000238187
  • 8110000238245
  • 8110000238860
  • 81211657
  • 81pvce
  • 82398766707
  • 835725326404
  • 8414111144
  • 84265
  • 848556755211
  • 84cpfy7t0
  • 8533578013
  • 855roed
  • 85jcwpx
  • 865974562405
  • 86756464476
  • 8676576804
  • 867725543315
  • 86rtmmyn
  • 872superset-prod.securchevy05b-usermanage
  • 8764424520
  • 87655342682101276542312
  • 8784565498487406
  • 87868467813
  • 87974321564623
  • 880147852717
  • 889632514905
  • 88bevd83bro2
  • 890716531806
  • 89653456678703
  • 8i90rt7
  • 8m6
  • 8pgll9pb8v
  • 8pi-q-ake
  • 8vboo42
  • 90097720
  • 903277
  • 9073097297608723607807832
  • 938521424
  • 94784560134915
  • 94ficy
  • 94ln5k
  • 94ryffrh
  • 9549559502
  • 96325874411
  • 97487482907903
  • 978764724556
  • 97898898807
  • 97qncm96
  • 97u18glaq8rfj.pcadmin
  • 98566447505
  • 9876456713
  • 98979461648405
  • 99234710
  • 9990939
  • 9999907
  • 99stephen-unifi
  • 9bc67659.op.cpanel.spin-event-ff-gratis43
  • 9eoqokni8i6pornjgfj9
  • 9z173c
  • 9zk2fsza
  • a-basit
  • a-memorial
  • a2net
  • a6sn6
  • a8d8czz
  • aacfmkgcyv
  • aafud
  • aajnlrkekg
  • aalpwys
  • aamjowsbcu
  • aando
  • aaqwkzwner
  • aarondqa
  • aaronfj1
  • aarong18
  • aarong9j
  • aaronh7o
  • aaronjoc
  • aaronjx8
  • aaronjxm
  • aaronktm
  • aaronp5t
  • aavainvhmd
  • ab.git.gitlab.gitlab.git.com2020.guai
  • abaissed
  • abbcurazwt
  • abc5147f4219d630b9c81b58541c7d43
  • abelnextcloud
  • abinir
  • abiudybitwarden
  • ablbkb
  • abnasmall
  • abneritconsulting
  • abnornell
  • abopdi
  • aboveandbelowparanormal
  • abysses
  • abzujhnltx
  • acc-info
  • acc-kamename
  • accesso-gratis-a-patreon-gold.tembi19peg
  • acceyaihdu
  • acchupcwqv
  • accorwyche
  • accounts.mail.google.com.mainservstats
  • accountscrchasevrfknl
  • acessonetwork
  • acexny
  • achamekikass
  • acinka
  • aclfcnwrhw
  • acroanesthesia
  • activasis
  • activation-netflix-ua
  • actual.apbresh
  • acwoffsite
  • acxklbgvvb
  • ad9152
  • adally
  • adapyxzlze
  • adcoma
  • addrumha
  • addrzg
  • adguard.hamraz
  • adhub
  • adillusbeast
  • adilwoulcd
  • adisdistribuidora
  • adju
  • adkal123
  • admindidi
  • adminwireguard
  • adobedobefile
  • adrianmeet
  • adsende
  • adubmbh
  • advance-server-garena12
  • advath.microsoft-dynamic
  • advhlwww.9mmreview
  • aeit
  • aeronomy
  • aertyuoljkhg
  • aetvqtyrrb
  • af8255lqqys4jsob26zdrylzzcfz998ifjndkt19p2wfx1m9of7mnwbgc5hfbjl.go053baseserv
  • afarkas
  • afcu1
  • afgxlhkzlx
  • afilli
  • afrs100survey
  • afslag7
  • afsmarthome
  • afy
  • agenpad
  • agh-test.tookwar
  • aglk
  • agmon-hass
  • agno94
  • agrestial
  • agustindns
  • agvagen
  • agvalwctwj
  • ahcdix
  • ahcgimqfzo
  • ahxvheyird
  • aifuydix
  • ailtgq
  • aintira
  • aio1001
  • aiqocj
  • aishaefred
  • aissuayzla
  • aitmtpgzpk
  • ajam13
  • ajdggseoix
  • ajdhsw
  • ajiandid4e8de
  • ajknpnlcog
  • ajmmc
  • ak-embeddings
  • akaweu
  • akinne-vps
  • aknssd
  • aksellcollabora
  • akxtzsdlee
  • alanakker
  • albait
  • albinhem
  • alblasserwaard
  • alcumvi
  • alegen
  • aleguido
  • alertsbanking-manageseceru-wellsfargo
  • alertyoursuspend
  • alesbrew
  • alexhassio-415
  • alexpradas2
  • alexsmarthome1
  • alfonsi
  • alfonsoserver
  • alikalonalo
  • alikroug
  • alkohol
  • allreportingsauthwellsfargousers
  • allthepotatos
  • alnanti
  • alokkkkgg
  • alpdvhgj2
  • alphafeature
  • alpiobvqja
  • alqrzinjbg
  • alsn
  • altripmag2
  • amaister
  • amandecold
  • amazon-signin-cgaktaudirieput-151
  • amazonverifggga
  • ambil-reward-ff
  • ambilhadiahcobramu
  • americanexpresss
  • amgmagewell
  • amices
  • amidata
  • amoiscvqji
  • amz-primerightnowd
  • amz-verification356
  • amzzzs
  • anacardiacloud
  • anacreontic
  • anadiwkxtw
  • anaphases
  • anarsoul.duckdns.orgns4
  • anaspides
  • ancafi
  • ancholiestate
  • andiiij
  • andras-perl-libro
  • androratkes
  • androratyagiz
  • andyj
  • aneeshss
  • anghhhtssf
  • ankh-morpork-city-watch-cosplay.purchre33mils
  • anlitert
  • annaditta
  • anniversary4thn
  • anocnen
  • anolop
  • anon2876
  • ansawpay
  • antazuna
  • antonioalvarezternero
  • antonsson
  • anubis.duckdns.org.taliadorradarr
  • anupamcloud
  • anushkatest
  • anwqsfkbdm
  • anzuhkpcsj
  • aobwhajnki
  • aofkjeohp
  • aosjqmadaz
  • aota
  • aotidtotv
  • aoxmzcmfqg
  • apc-ups.south-fork
  • apcr
  • aperture.green-v
  • apfrog28
  • api.pyboxtechcatholic
  • apigw
  • aplitecsi
  • aponeurotome
  • app-measurement
  • appeasably
  • appl
  • apponyi9
  • appreplayactivity-2023
  • appsamzprime-information
  • aqnwk4jfj
  • aquamars
  • aquilaxxd
  • aqybyxcugb
  • arandina
  • araujos
  • arcane-house
  • archmisha-home
  • archness
  • ardyd
  • arergasde
  • arhzojuaoy
  • aries0104mailru
  • ariffloor
  • arikulgar12
  • arjjlbsomv
  • arldtcloud
  • armadas
  • armmnluvwn
  • arstec
  • art-home
  • arteriosympathectomy
  • arthurolv
  • arti7
  • arunyx
  • arvest-id1
  • arvest-ld
  • arville
  • arviragu
  • asalda54
  • ascb4
  • asd3daf3
  • asdsadsad34e3
  • asedxngfwr
  • aseugradosnj
  • asfsdfsdf
  • asgardianvpn
  • ashass
  • ashjhq0
  • asiermsrnexcloud
  • asjkayuera
  • ask11079
  • ask18268
  • ask5725
  • ask7359
  • ask7642
  • ask7660
  • ask7676
  • ask7704
  • ask9359
  • askenian1
  • aslydegrea
  • asohn
  • asox-ad0behost-nov16-5
  • aspengrove
  • aspire-jellyfinmediaserver
  • aspolotresay
  • assassa33
  • asset.ubatt
  • assets.mcxdiego.prime.amazon.dev.athome2
  • assitfed
  • asylummc
  • atduloaeai
  • atenllot
  • aticeb
  • atipreviz
  • atm9kristen
  • atsurtown
  • auajeeuyrt
  • aubreytsaurel
  • audri
  • audxwpyaeiozv
  • auh3yb3
  • auhikari-sso-nifty-jp
  • auntljcaah
  • aurelien
  • ausrhino
  • auth-secure-pnc
  • auth.hetznervpn
  • auth.kurwa-wg
  • auth.kuzimoto
  • auth.nemexur-vpn
  • auth.suavipien
  • auth.theoneoccat
  • auth.warmonger
  • auth17
  • autipanen-ress-curl89
  • autoconfig.nca.alexcloudhosting
  • autodiscover.00002546217
  • autodiscover.000123952914
  • autodiscover.0001354
  • autodiscover.00024731214
  • autodiscover.000256518
  • autodiscover.0006365356002
  • autodiscover.0007825
  • autodiscover.0007865
  • autodiscover.0012156531
  • autodiscover.001247
  • autodiscover.00197703320
  • autodiscover.0232000252
  • autodiscover.0876140
  • autodiscover.0911298
  • autodiscover.092141828
  • autodiscover.1000234984009
  • autodiscover.1000234984123
  • autodiscover.1000234984387
  • autodiscover.1000234984417
  • autodiscover.1000234985183
  • autodiscover.1000234985296
  • autodiscover.1000234985552
  • autodiscover.10002435452329
  • autodiscover.1000989813
  • autodiscover.100105515106
  • autodiscover.100125946206
  • autodiscover.100155812810
  • autodiscover.100191415906
  • autodiscover.1002365896589607
  • autodiscover.10032041519
  • autodiscover.100320415813
  • autodiscover.100398262705
  • autodiscover.100464759407
  • autodiscover.100518819420
  • autodiscover.100622572319
  • autodiscover.10065858410
  • autodiscover.100989329405
  • autodiscover.10099150505
  • autodiscover.1011134984369
  • autodiscover.1011134984645
  • autodiscover.1011134985003
  • autodiscover.1011134985015
  • autodiscover.1011134985197
  • autodiscover.101185564709
  • autodiscover.101280335613
  • autodiscover.101402525508
  • autodiscover.101402525516
  • autodiscover.101493476216
  • autodiscover.102082479206
  • autodiscover.1022011012
  • autodiscover.1022011016
  • autodiscover.102313085309
  • autodiscover.102395722818
  • autodiscover.102673875105
  • autodiscover.1027875610
  • autodiscover.10280021506
  • autodiscover.103241818104
  • autodiscover.10340465201
  • autodiscover.103774035814
  • autodiscover.104247908914
  • autodiscover.104251341913
  • autodiscover.104315282117
  • autodiscover.104761231705
  • autodiscover.104911284406
  • autodiscover.104914321119
  • autodiscover.1055027510
  • autodiscover.10562202809
  • autodiscover.105695531614
  • autodiscover.105745755410
  • autodiscover.105745755413
  • autodiscover.105841042101
  • autodiscover.106064322409
  • autodiscover.106288899115
  • autodiscover.10632536119
  • autodiscover.106361101314
  • autodiscover.10693153220
  • autodiscover.107757374712
  • autodiscover.10778974817
  • autodiscover.107853465620
  • autodiscover.10801247501
  • autodiscover.108373775212
  • autodiscover.108512701117
  • autodiscover.109084460706
  • autodiscover.109111828508
  • autodiscover.109157463809
  • autodiscover.109387814601
  • autodiscover.109431395214
  • autodiscover.10957465418
  • autodiscover.109807577915
  • autodiscover.110250263720
  • autodiscover.110471551409
  • autodiscover.110590268105
  • autodiscover.110665358418
  • autodiscover.110955811811
  • autodiscover.111064391817
  • autodiscover.1111232211411100
  • autodiscover.111235208601
  • autodiscover.11152799817
  • autodiscover.111920804816
  • autodiscover.113257227818
  • autodiscover.113654879657
  • autodiscover.114174015102
  • autodiscover.114324254539
  • autodiscover.114764141502
  • autodiscover.115030874909
  • autodiscover.1152698745605
  • autodiscover.115298928207
  • autodiscover.116713471407
  • autodiscover.117266049618
  • autodiscover.117452254605
  • autodiscover.118067454810
  • autodiscover.118286327916
  • autodiscover.1201203927
  • autodiscover.1212216548
  • autodiscover.1233134151
  • autodiscover.1253452413
  • autodiscover.125521230
  • autodiscover.12786584307
  • autodiscover.128798307805
  • autodiscover.137528501619
  • autodiscover.14106379606
  • autodiscover.142145835811
  • autodiscover.147941161805
  • autodiscover.149100598412
  • autodiscover.151421561201
  • autodiscover.15270392407
  • autodiscover.154551218931
  • autodiscover.154551219146
  • autodiscover.154551219405
  • autodiscover.154551219626
  • autodiscover.154551219724
  • autodiscover.154551220035
  • autodiscover.154551220340
  • autodiscover.154551220509
  • autodiscover.155188156620
  • autodiscover.15614513608
  • autodiscover.156334831805
  • autodiscover.15841648404
  • autodiscover.162366280402
  • autodiscover.162805319819
  • autodiscover.16740590916
  • autodiscover.167477737904
  • autodiscover.17364524905
  • autodiscover.179419892218
  • autodiscover.181006868906
  • autodiscover.181006868915
  • autodiscover.185747833715
  • autodiscover.187138801313
  • autodiscover.191938174213
  • autodiscover.192032007617
  • autodiscover.196875952
  • autodiscover.20002423422
  • autodiscover.20071941
  • autodiscover.201054740619
  • autodiscover.2023151917
  • autodiscover.202486670704
  • autodiscover.204890629711
  • autodiscover.209227318410
  • autodiscover.21364987910
  • autodiscover.215495
  • autodiscover.21651613264
  • autodiscover.217500438208
  • autodiscover.219830572305
  • autodiscover.222142141222
  • autodiscover.2222222222125
  • autodiscover.222283
  • autodiscover.22253658563626
  • autodiscover.22290903
  • autodiscover.22867678777830
  • autodiscover.231249635309
  • autodiscover.23244188
  • autodiscover.258361652805
  • autodiscover.282585431915
  • autodiscover.28888000018
  • autodiscover.310454127505
  • autodiscover.32109910238335
  • autodiscover.32109910238564
  • autodiscover.32154655619
  • autodiscover.32243465610
  • autodiscover.3333333333313
  • autodiscover.334466719
  • autodiscover.343532508
  • autodiscover.3543657448
  • autodiscover.361115863904
  • autodiscover.364417557612
  • autodiscover.36590754313437
  • autodiscover.39625918714
  • autodiscover.399999909
  • autodiscover.42124444
  • autodiscover.43231356
  • autodiscover.43242423412435
  • autodiscover.4343567653
  • autodiscover.4353406
  • autodiscover.444125698588503
  • autodiscover.44444104
  • autodiscover.450771012608
  • autodiscover.4535464023
  • autodiscover.4535464089
  • autodiscover.45365240
  • autodiscover.45423401648
  • autodiscover.45423402244
  • autodiscover.45423402248
  • autodiscover.45423402254
  • autodiscover.45423402267
  • autodiscover.45423402556
  • autodiscover.45675443537
  • autodiscover.45785212
  • autodiscover.4768899767826
  • autodiscover.482107123718
  • autodiscover.4897655809401
  • autodiscover.494211560916
  • autodiscover.49760056713
  • autodiscover.5003982819
  • autodiscover.5057857
  • autodiscover.511110000017
  • autodiscover.512581745711
  • autodiscover.51258174714
  • autodiscover.530734816906
  • autodiscover.535475874650
  • autodiscover.536474589352
  • autodiscover.54111331023
  • autodiscover.546453556712
  • autodiscover.54984981674
  • autodiscover.552233658555214515
  • autodiscover.555555552610
  • autodiscover.5649875544
  • autodiscover.565145733919
  • autodiscover.565434335
  • autodiscover.565710800120
  • autodiscover.567463423401
  • autodiscover.569999793115
  • autodiscover.575765861
  • autodiscover.608940916113
  • autodiscover.63263273534
  • autodiscover.633967736707
  • autodiscover.63457497416
  • autodiscover.643222115
  • autodiscover.645227048916
  • autodiscover.645813122105
  • autodiscover.646507454514
  • autodiscover.6468524278
  • autodiscover.65333987412601
  • autodiscover.653478943123
  • autodiscover.653763565739
  • autodiscover.65432155443611
  • autodiscover.6549383645605
  • autodiscover.6578292925242606
  • autodiscover.6578745017
  • autodiscover.65874302578619
  • autodiscover.66395363414
  • autodiscover.66635895252502
  • autodiscover.668186749817
  • autodiscover.6743653427
  • autodiscover.6788834
  • autodiscover.685440534917
  • autodiscover.70036009212
  • autodiscover.714252848719
  • autodiscover.718501171616
  • autodiscover.719965098315
  • autodiscover.7364196917310
  • autodiscover.7387385815
  • autodiscover.7387385897
  • autodiscover.74461403519
  • autodiscover.75221146
  • autodiscover.755509
  • autodiscover.7564553276
  • autodiscover.76359842354515
  • autodiscover.765734211524
  • autodiscover.76765605
  • autodiscover.77712365482507
  • autodiscover.77776652304
  • autodiscover.777776543216
  • autodiscover.777776543219
  • autodiscover.7864339
  • autodiscover.7864354
  • autodiscover.787898852
  • autodiscover.78954987478712
  • autodiscover.79654346015
  • autodiscover.79895641156912
  • autodiscover.80008263457628
  • autodiscover.802534433345886605
  • autodiscover.8110000238199
  • autodiscover.8110000238600
  • autodiscover.815316848807
  • autodiscover.848556755212
  • autodiscover.85201470717
  • autodiscover.85214736919
  • autodiscover.85784525501
  • autodiscover.868686804
  • autodiscover.874563214515
  • autodiscover.8764287629
  • autodiscover.876543456603
  • autodiscover.876547895417
  • autodiscover.876687601
  • autodiscover.8788508
  • autodiscover.879402938717
  • autodiscover.8813881010
  • autodiscover.88234315
  • autodiscover.88585442502
  • autodiscover.886754
  • autodiscover.8889030
  • autodiscover.89012308
  • autodiscover.89324877501
  • autodiscover.89654741303
  • autodiscover.89654756304
  • autodiscover.8998561118
  • autodiscover.910609522410
  • autodiscover.9121212308
  • autodiscover.92578946406
  • autodiscover.96247578712
  • autodiscover.96325874917
  • autodiscover.96586321408
  • autodiscover.96874532406
  • autodiscover.97445518707
  • autodiscover.978764724562
  • autodiscover.98426161513
  • autodiscover.98745687919
  • autodiscover.988241301315
  • autodiscover.99234707
  • autodiscover.9990919
  • autodiscover.calvintest1
  • autodiscover.g12301
  • autodiscover.login-0014
  • autodiscover.mollriekone
  • autodiscover.redirection02-secured
  • autodiscover.sign-in501
  • autodiscover.verify-navyfederal
  • automaticbeach
  • autonomy1
  • auwqqpqlfr
  • auwzhadgqt
  • auyphzbhhr
  • avacadotg
  • avannet
  • avast258
  • avidgobtjv
  • avieira-home
  • avifilmopjz
  • avobee2
  • avontis
  • avuidvmvbx
  • avzsgzeuof
  • awagis
  • awasubvefy
  • awbrootaoy
  • awesemo
  • awfngbhewd
  • awgibbons
  • awhlvpn
  • awlkeykawo
  • awqajgxkda
  • axbocjlijo
  • aziendagallo
  • azone40
  • azor
  • azriel
  • azxlkzcljh
  • b-b-b
  • b0faservtemp
  • b3r
  • b3v8wnancy47
  • b6bc745a-7b5c-4d56-ab6c-0dd2982cb122.random.riwtfdkgwm
  • b7i
  • ba00lgdz
  • baanzmmlxx
  • babyblues
  • baccont11frem
  • backofamericacount
  • backup.auralexthib
  • backupseidel
  • badi
  • badiqe
  • badmarriageforhost
  • bagi-bagi-event-gratis-2022
  • bagi-bagi-vidio-viral2022
  • baguette11
  • baitalimaan
  • baixar-jogo-de-carro-de-volante
  • baixar-matlab-gratuito
  • baixar-street-fighter-5-pc
  • baixar-tor
  • bajde
  • bakeryhomecontrol
  • balkan-architect-patreon.tiszard48myrt
  • ballen
  • bananalord
  • bandeja
  • banderillero
  • bandicot
  • bangsize
  • baodnas
  • bapopocaisseregiont
  • bara.gecont95lui
  • barbunassh
  • bark
  • barloukahassio
  • barreirapedro
  • barroco
  • basehomeass
  • basemental-drugs-patreon.lasec16budd
  • baso29me
  • basodsi
  • basscloud
  • batatahomeassist
  • batelg
  • baterilla
  • batobyeyw
  • batu33tr-web
  • batwavedocumentserver
  • bavkwodlmj
  • bavu1
  • bawan
  • bazarr.triceratops2
  • bb1z88nxr
  • bbnu74
  • bbnubj
  • bbnvpn
  • bbnwf0
  • bbny3u
  • bbnz7s
  • bbnz9n
  • bbo01h
  • bbo0v3
  • bbo14w
  • bbo2uc
  • bbo4dr
  • bbo50h
  • bbo7kj
  • bbo879
  • bbo8m4
  • bbo8no
  • bbox-cdk
  • bbun
  • bcirhjenkins
  • bcixceohid
  • bcjlkcmrvn
  • bcoblaco
  • bcpm04
  • bcwildlife
  • bda86
  • bdbbknferz
  • bdcewdsdyl
  • bdshepard
  • bdudciznpz
  • bdvdha
  • beanbrigademc
  • bebraserver52
  • beckerbasis
  • becknetsrv
  • becu-oniinever1fy
  • becu-support
  • becuma
  • bedtop
  • beechtree
  • beefworld
  • begakirk
  • beiprecip
  • belinned
  • belizaassistant
  • bellboybellboy
  • belledelphine-patreon-pics.pemy66hu
  • bemuteav
  • benevolus
  • benjnet
  • bershka
  • bertini24
  • bestfoammattress
  • betapi-jameson
  • betonbeorge
  • beuvilcomp
  • bfbfbqbfun
  • bfefibxbyl
  • bferris
  • bffudogowl
  • bfivamfxah
  • bfoxrjavzw
  • bfsbidejmg
  • bgf23hfgh
  • bgmi-event
  • bgplyibiziwx
  • bhl2dwfq
  • bhrevqaguv
  • bibliopdgf3
  • bibliopdh8e
  • bibliopdhdc
  • bibliopdkvi
  • bibliopdnee
  • bibliopdpaw
  • bibliopdprz
  • bibliopdshb
  • bibliopdvlv
  • bibliopdycb
  • bibliopdz24
  • bibliope0f8
  • bickmail
  • bieyznuyrp
  • biggqtdoyi
  • bigshare
  • bigtarsier
  • billycloud
  • bimaka
  • bimaxy
  • bimwbhmuxal.ha-mordor
  • binarypickle
  • bingpowsonarr
  • biniegrillo
  • biockchan
  • biodejgzfq
  • bioigen
  • biorythmic
  • bipnwtelek
  • bisadongjuahohtakbisaqwe123123
  • biskmytwkp
  • bitcoinown
  • bitwarden.maaktnietuit
  • bitwardenfran
  • bjbe
  • bjerre-iot
  • bkaevjppdy
  • bknuckles
  • bkoxiiuylo
  • bkpvrl1-xxvip
  • black-hole
  • blackadobe
  • blackduck-ncp
  • blackhatdubai
  • bladibla.kinlao
  • blakeha
  • blandbloc
  • blgchkauor
  • blhcictrzy
  • blhirrnnre
  • blitzplex
  • blixflix
  • blkkkqogbr
  • blog.gitlab.gitlab.gitlab.gitlab.secur4me
  • blog.hshproxy
  • blokino4
  • blompiten
  • bloodis
  • bloodlust-gerene-3d-affect.drivam53day
  • blue-whales
  • blumtuta
  • blynkop
  • bm4vyg
  • bmodsl
  • bndmaidcswud
  • bnhqqo
  • bo-fatfreddys
  • boagaqargv
  • bobrock
  • bodda
  • bodlkazcry
  • bohoseh
  • bohrer-adm
  • bohsystzys
  • bojanb
  • bokep-grup-jepang
  • bokep-indo-viral6253
  • bokep-indo2022
  • bokephot05
  • bokepindo55
  • bokepterbaru-2021
  • boleang
  • bongonation77
  • bonobot
  • bonra
  • bookfart
  • boredorb
  • borgemarka
  • borovice2
  • boscaler
  • bossow-web
  • botsv
  • bouduljbkx
  • bowg
  • bowtie-demo
  • bpdgttgfgs
  • bpwsbmkeyd
  • bqimuoyruo
  • brathe
  • brendasosadisenografico.blog.store.dianji
  • breoliped
  • bretmfypcw
  • brianpc
  • brickwedde
  • brigitte
  • brisbohpe
  • britec
  • brizland
  • brocklesby
  • brownes-farm
  • bruising.green-v
  • brunneis
  • brunolinsalves
  • brvgwcy1x
  • bsil
  • bsmupmsgpx
  • bsoolk65
  • bsoolm3l
  • bsooltxo
  • btmkgxcakw
  • bucysxda
  • buehler
  • bug-codashop-gratis21
  • bug1-evnt
  • buihuuthanh
  • buipienu9q
  • buka-crate-freefire-terbaru
  • bundle-gratis85
  • burgon
  • burncisi
  • burnleyywinnss
  • burntchef
  • buyblogto
  • buywvzzjrx
  • buznyacor
  • buzruca
  • bv.hackashaq
  • bviqhmpk
  • bvjmqmfkbw
  • bw-geras
  • bwnavqbqmo
  • byczzlvhcf
  • byrned
  • bysxdjpybc
  • byvrsfrmno
  • bzmxqvsodz
  • bznettqbxe
  • bzpncbqgfk
  • bzwkbtzgex
  • bzzazqmmkj
  • c01m3kv1d30
  • c1szsf21
  • c2v4
  • c33-cpanel
  • c3iti-verf
  • c3tbmz
  • c4cb8a9b.vps.webdisk.coda25
  • c4csnp
  • c7
  • caasinextcloud
  • cadvault
  • cafezinlaranjeiras
  • cafnextcloud.duckdns.orgcafnextcloud
  • caissegionalca
  • caissgrenionas
  • caive66nex
  • califaxtwo
  • calinjh
  • campagna
  • campusbook
  • camsfarmhouse
  • candeskfast
  • candycane
  • canohealth
  • cap1plex
  • capaseotaw
  • capitulo-116-dragon-ball-super-descargar-mega.starap67rei
  • captainsly
  • cara-membuat-akun-forex-trading.top-10-exchanges.best-forex-brokers-and-trading-platforms-in-new-zealand.daytrading-fur-beginner-bleikolm-stefan-mrsic-damir.cara-membuat-akun-demo.cara-aman-trading-forex-ikuti-saran-trader-muda-in.www19
  • carayuno
  • cardinalplace.orgt.idts.detmer
  • cardrick
  • cardtiga
  • carloseugenio
  • carolps3224m
  • cartassistno2
  • carzo
  • casa-nicksoft
  • casabonoc
  • casacarasau
  • casacossa
  • casadiminoefatima
  • casadossonhos
  • casagraniti
  • casamavrav
  • casamgm
  • casamyvgandia
  • casaos.vaidyanilayamcloud
  • casaparra
  • casaricardojb
  • casarvis
  • casiim
  • casotta
  • cast12345
  • castillovargas
  • castlesmpbuss
  • catboy22
  • cathcasisstions
  • catroux
  • catserver69
  • causable
  • cavallo
  • caveator
  • cb42981fb53c710f9ae18ca9237ee7a1
  • cbappserver02
  • cbnnc
  • cc7zhspk
  • cca-admin
  • cchddeieah
  • cchgemdwsy
  • ccongqkwut
  • cctressy
  • cctreuvc
  • cctrewey
  • cctrf0gi
  • cctrf12q
  • cctrf249
  • cctrf2sf
  • cctrf3qg
  • cctrf4hu
  • cctrf79q
  • ccxrdatfhb
  • cdiwfduvmi
  • cdkzpuu
  • cdskjfhew
  • cdtwiaypzh
  • cdvakheg
  • cdzkxapgog
  • ceinami
  • celestianx
  • cementerio-123
  • cenedese
  • centauricloud
  • centraalspoor
  • centvami
  • cerebrate
  • cerevos-mercure
  • cesgeode
  • cetuhusgnh
  • cf706db7.cpcalendars.spinevengratis-freefire
  • cfa97859-pt130409104.norrpert60steam
  • cfoxvrwavo
  • cfranck
  • cfycauoerl
  • cgikdxytuy
  • cgyyzkrxnm
  • chacahuala
  • chaegravaj
  • chafobu
  • chalfomo
  • chamberlayne
  • chapadap
  • charajfklx
  • charles-rijken
  • charli1
  • charllie
  • charon
  • chase-makebr-acscrnt
  • chase07secured
  • chasesecure07verify
  • chat.kilin
  • chavezflix
  • chbnfooqdc
  • chdbclmign
  • che-workspace.workspace.trt-mibl
  • chemilako
  • cheperre
  • chesleukar
  • chettrongtimsau00i
  • cheyannenorma
  • chh96ha
  • chiasyci
  • chieti
  • chikamopropinchi
  • chikaterbarufullnosensor2022
  • chikawick
  • childofhouse
  • chimassuo
  • chiptronico
  • chiquitinha
  • chkjjmta-sts.doubilan
  • chneswsdy8wealthandorganisationjokbo
  • chodashop-idgame
  • cholanthrene
  • chorgau
  • christy-mack-lesbian-sex-video.soere46die
  • chronos.cyberllama
  • churocraft
  • chvet
  • ci.video-japan-margaret-hill-wnp
  • ciceke
  • cifconfpet
  • cigmvsixri
  • cilimi
  • ciotapur
  • cioticdy
  • ciphertexx
  • citizensbank-usa
  • citizensonline-echannel
  • citizenssosalerts
  • city-of-words
  • ciynpnngvc
  • cjbzuvouhd
  • cjgepfjmsu
  • cjkrycwxrv
  • cjsocebzrf
  • cjxnocbhbd
  • ckan
  • ckicmpxokv
  • ckjekltsdz
  • cklreqkqwl
  • clae
  • claim-allskin-vip992
  • claim-angel-ff158
  • claim-create-terbaru-12
  • claim-even85
  • claim-event-ff-gratis222
  • claim-event01
  • claim-eventt20211
  • claim-evnt-ffnew202
  • claim-ff-229
  • claim-garena06
  • claim-hadiah-freefire19
  • claim-hadiah-gratis-81
  • claim-hadiahff25
  • claim-hadiahgratis223
  • claim-item-ff19
  • claim-item-freefire-darigarena690
  • claim-item-freefiremax-gratis
  • claim-item23
  • claim-itemffggwpo
  • claim-itemjr14
  • claim-kulgar-1
  • claim-ml277
  • claim-skin-ml-gratis09
  • claim-skin-mobilegend
  • claim-skin-terbaru-mlbb-colector
  • claim.gratis-sekarang
  • claimeventfreefirefree
  • claimeventgarenafrefire01
  • claimeventty
  • claimgarena-free
  • claimgratis6178h
  • claimhadiah-gratisnya2021
  • claimhadiahdisini29
  • claimhadiahgratisitemlngka
  • claimhadiahhmu
  • claimhadiahmobilelegend-2022
  • claimskinvipgarena
  • clamfreegarena
  • clamsduk
  • claper.lucadonny
  • clarksyuma
  • clash-dmit
  • classifiedgaming
  • clavellserver
  • cleverest-eu
  • client
  • clienteacessocaixagov1
  • clientesopen
  • clientsrv5-amz
  • cloud-42
  • cloud-barraco
  • cloud-kyco
  • cloudpolynasa
  • cloudrezpa
  • cloudxlive
  • clpmeensve
  • clubriote
  • cluthegrid
  • clvqakbdjq
  • cmctest
  • cnasrgdt
  • cnc-monitora
  • cncczencsn
  • cnet
  • coberup
  • coda-neww-ff
  • coda-shop-true-id-vip9
  • codaashopkp
  • codaevent78
  • codafty-xcv77
  • codashop-677
  • codashop-berbagi-diamond
  • codashop-eventgarena6.duckdns.orgcodashop-eventgarena6
  • codashop-free-global
  • codashop-free-v2
  • codashop-gratis462
  • codashop-item-ff
  • codashop-top-up-diamon
  • codashop6273
  • codashopevent-bug2k21
  • codashopid-mamang23
  • codashopin
  • codashopthr
  • codaxshop2021
  • code-server.cuspier
  • code.feangol
  • coder-leo15
  • codsshopgratis
  • coekutorxh
  • coffeenode
  • coflimeadd
  • cokoexdu
  • collabora.navatuseinserver
  • colmek.abgmontok
  • comerc-inten-update
  • comesialvieira
  • comic-book-girl-19-cosplay-blade-runner-nsfw.bensriff36clav
  • commonsensically
  • comola
  • compaestrenos12
  • comppore
  • conakry
  • concessionaire
  • conditio-humana
  • conductitious
  • conmed-n
  • connecting-to-service321
  • conpho30voi
  • consgorre
  • consulting-sa
  • contact-courier
  • controlum
  • contsmilin
  • conundrums
  • cookles
  • corbch
  • cosashop-event
  • cosmoserver
  • costumer-de-se-appcount
  • cotillon
  • couch
  • counterpaled
  • coxtower
  • coyariv
  • coyossawx
  • cpanel.000075123215
  • cpanel.001247
  • cpanel.0090081219
  • cpanel.0122224307
  • cpanel.02202202204
  • cpanel.03216501011
  • cpanel.0682567211
  • cpanel.077747209
  • cpanel.0876125
  • cpanel.089513876516
  • cpanel.09713747
  • cpanel.0paypal
  • cpanel.0secure-netfiix0verify
  • cpanel.1000234984634
  • cpanel.1000234984675
  • cpanel.1000234985430
  • cpanel.10005354811
  • cpanel.100073645723
  • cpanel.100308226403
  • cpanel.100799815706
  • cpanel.100833161902
  • cpanel.1008523415
  • cpanel.100991505609
  • cpanel.10105087596
  • cpanel.1011134984219
  • cpanel.1011134984692
  • cpanel.1011134984757
  • cpanel.10136266902
  • cpanel.101371784702
  • cpanel.10145227902
  • cpanel.101452279302
  • cpanel.10168946313
  • cpanel.1021876415
  • cpanel.102253552102
  • cpanel.102253552105
  • cpanel.10275839607
  • cpanel.103271575306
  • cpanel.103391119403
  • cpanel.10342812802
  • cpanel.10355337417
  • cpanel.103785274406
  • cpanel.103851922503
  • cpanel.103944855809
  • cpanel.104049829209
  • cpanel.104100462606
  • cpanel.104392145509
  • cpanel.104393957514
  • cpanel.104462559112
  • cpanel.10447481414
  • cpanel.104474814616
  • cpanel.104663138207
  • cpanel.10503015109
  • cpanel.105237808514
  • cpanel.105443648118
  • cpanel.105695531616
  • cpanel.105877982816
  • cpanel.105942825419
  • cpanel.106053935120
  • cpanel.10636972820
  • cpanel.106817794318
  • cpanel.106903205601
  • cpanel.107033097902
  • cpanel.107193045319
  • cpanel.1074835513
  • cpanel.107614685515
  • cpanel.107759615405
  • cpanel.107816260507
  • cpanel.107875558517
  • cpanel.10795323818
  • cpanel.10801247512
  • cpanel.108128418510
  • cpanel.108207618905
  • cpanel.108207618908
  • cpanel.108509621719
  • cpanel.108636451608
  • cpanel.108649054413
  • cpanel.108919901906
  • cpanel.109218960608
  • cpanel.10957465416
  • cpanel.109724568601
  • cpanel.11000979
  • cpanel.110382493717
  • cpanel.110621708116
  • cpanel.11110224321
  • cpanel.111191817318
  • cpanel.111211838111
  • cpanel.111218977108
  • cpanel.11126300512
  • cpanel.111682444712
  • cpanel.11188891
  • cpanel.11219250715
  • cpanel.112192507413
  • cpanel.112563238506
  • cpanel.112563238511
  • cpanel.113652238501
  • cpanel.113744181707
  • cpanel.114324254547
  • cpanel.114772994802
  • cpanel.114983098111
  • cpanel.1156738404
  • cpanel.117263258504
  • cpanel.11mcndhfbvgrrjaksdjghaskdjh
  • cpanel.120038021309
  • cpanel.122452771409
  • cpanel.12341411
  • cpanel.124543212317
  • cpanel.12637116447
  • cpanel.126984323220
  • cpanel.132912020515
  • cpanel.13938791709
  • cpanel.13938791714
  • cpanel.143301225316
  • cpanel.148469407514
  • cpanel.149786919315
  • cpanel.150842284908
  • cpanel.153942415305
  • cpanel.154551219331
  • cpanel.154551219375
  • cpanel.154551219686
  • cpanel.154551219823
  • cpanel.154551219982
  • cpanel.154551220036
  • cpanel.154551220170
  • cpanel.154551220243
  • cpanel.154551220676
  • cpanel.154593676512
  • cpanel.156145136801
  • cpanel.161718089815
  • cpanel.163852197511
  • cpanel.167420714817
  • cpanel.170346602304
  • cpanel.171388109520
  • cpanel.17421358218
  • cpanel.194008523903
  • cpanel.194008523911
  • cpanel.196658795423664
  • cpanel.1la7qi-0005ou-1g
  • cpanel.1lj2lw-0008fx-as
  • cpanel.1lugf6-0000zk-qe
  • cpanel.1mgsal-0005qf-rw
  • cpanel.1mjp8r-0001gw-c0
  • cpanel.1mmccp-0004ov-6x
  • cpanel.1mu1qt-0006jk-tq
  • cpanel.2021garena-freeeventnewsz4
  • cpanel.202486670716
  • cpanel.21316466
  • cpanel.21321014
  • cpanel.2141133143
  • cpanel.2145625707
  • cpanel.2156784301
  • cpanel.2222576466282
  • cpanel.2223496466297
  • cpanel.22607175601
  • cpanel.233690272613
  • cpanel.23910875717
  • cpanel.24258958726351
  • cpanel.243544411
  • cpanel.243544451
  • cpanel.24766494919
  • cpanel.24811968520
  • cpanel.25364634149
  • cpanel.262406797105
  • cpanel.26720561502
  • cpanel.280635495312
  • cpanel.283433393601
  • cpanel.289894446608
  • cpanel.292044677607
  • cpanel.29756324904
  • cpanel.3030305504
  • cpanel.30671
  • cpanel.308047009915
  • cpanel.32109910238367
  • cpanel.3214662523
  • cpanel.3215559
  • cpanel.3256212
  • cpanel.328520297812
  • cpanel.3325478010
  • cpanel.340037519409
  • cpanel.3411757256
  • cpanel.34223156
  • cpanel.345287128719
  • cpanel.3480073
  • cpanel.35097957809
  • cpanel.35353643401
  • cpanel.35353643489
  • cpanel.3543657435
  • cpanel.356652123133613
  • cpanel.358358521110
  • cpanel.360858241416
  • cpanel.3646452815
  • cpanel.37hjsm
  • cpanel.3mtbsecures
  • cpanel.406141286513
  • cpanel.40kuotagratis
  • cpanel.4235362609
  • cpanel.431343553817
  • cpanel.432667989452
  • cpanel.4360089
  • cpanel.4443585212
  • cpanel.444444444424
  • cpanel.444458236566283
  • cpanel.4451122119
  • cpanel.44556649
  • cpanel.44754379114
  • cpanel.44757535552
  • cpanel.45423401642
  • cpanel.45423402330
  • cpanel.45423402713
  • cpanel.45451170
  • cpanel.45626574532340
  • cpanel.459108220818
  • cpanel.4623547388227
  • cpanel.469233939814
  • cpanel.472559539401
  • cpanel.4758687620
  • cpanel.4768687443509
  • cpanel.49559818
  • cpanel.4987630049865420
  • cpanel.4request4service-alert7information4alert
  • cpanel.5050908010
  • cpanel.50550550
  • cpanel.51458760
  • cpanel.51774949517
  • cpanel.530734816906
  • cpanel.545342323
  • cpanel.5453456576
  • cpanel.54624273544418
  • cpanel.5465100128
  • cpanel.546575656401
  • cpanel.54685645712
  • cpanel.547868956
  • cpanel.547896321404
  • cpanel.55210802
  • cpanel.55555553333213
  • cpanel.556785153
  • cpanel.55790010
  • cpanel.558597417813
  • cpanel.5615461219
  • cpanel.5636531
  • cpanel.5697104608512
  • cpanel.569888376307
  • cpanel.573000716105
  • cpanel.580409235702
  • cpanel.5mz7laj8jqjovsm
  • cpanel.6025498799704
  • cpanel.60291503418
  • cpanel.607446795410
  • cpanel.63263273522
  • cpanel.635497841124811
  • cpanel.652409408108
  • cpanel.65335687802
  • cpanel.6574423087617
  • cpanel.6575833318
  • cpanel.66535645754
  • cpanel.6666535353510
  • cpanel.6675024
  • cpanel.672740232816
  • cpanel.685412245408
  • cpanel.69456335287903
  • cpanel.69869
  • cpanel.725288087514
  • cpanel.72647635011
  • cpanel.730889790311
  • cpanel.7319749504
  • cpanel.7451001506
  • cpanel.755442124
  • cpanel.75647410807
  • cpanel.7625423
  • cpanel.7634121195
  • cpanel.7684732948
  • cpanel.76957397603
  • cpanel.7729833
  • cpanel.778701
  • cpanel.7846283
  • cpanel.78765557707
  • cpanel.7895546510
  • cpanel.7895546511
  • cpanel.796760644586505
  • cpanel.79712127
  • cpanel.798546131202501
  • cpanel.802215411100688600
  • cpanel.802531113345886611
  • cpanel.802534444445886639
  • cpanel.8181818181011
  • cpanel.847927582341
  • cpanel.85247658414
  • cpanel.85554216
  • cpanel.86948489975710
  • cpanel.87483463487
  • cpanel.8763538098702
  • cpanel.8763538098716
  • cpanel.8764287685
  • cpanel.87654789702
  • cpanel.87655424511
  • cpanel.87999946724414
  • cpanel.882823
  • cpanel.88686766518
  • cpanel.8881103
  • cpanel.8885695585914
  • cpanel.8889043
  • cpanel.8889094
  • cpanel.8963214702302
  • cpanel.8965475604
  • cpanel.8965477403
  • cpanel.89657457317
  • cpanel.900015433
  • cpanel.901245799
  • cpanel.909875437
  • cpanel.925789464418
  • cpanel.951244361813
  • cpanel.96566419
  • cpanel.97179522901
  • cpanel.97684342312420
  • cpanel.98654262
  • cpanel.9875126417
  • cpanel.987564796506
  • cpanel.98765786413
  • cpanel.989852508
  • cpanel.9900254
  • cpanel.994353158805
  • cpanel.9950100012
  • cpanel.995010006
  • cpanel.9987666510
  • cpanel.9987666515
  • cpanel.999554627
  • cpanel.9996852689601
  • cpanel.accesorieswnt
  • cpanel.accountinformation
  • cpanel.accountmanagement-imchmail
  • cpanel.adhost-kiroojb
  • cpanel.adi-nesia-panel-murni
  • cpanel.adobesobshare
  • cpanel.advance-server-11
  • cpanel.advanceserverfireefire
  • cpanel.agosupportapplestorelockedminageasdj7sis
  • cpanel.ain.aja.eventsahur
  • cpanel.ajmaylee05c
  • cpanel.akuaiahkaijss
  • cpanel.aleioiyuafakcacs
  • cpanel.amazon07protection
  • cpanel.amazonaccount-servicecentres045
  • cpanel.ambil-hadiahmu-2021
  • cpanel.ambildiamond-gratisdari-codashop
  • cpanel.ambillah-hadiahmu-2021
  • cpanel.amz-pageserv012
  • cpanel.amzn-signin-8712nv6b41sent21-202
  • cpanel.amzn-signin-871mkv251
  • cpanel.amzon-signin-817kvb283
  • cpanel.amzprimemembershipzkwb
  • cpanel.amzservice-securitysupport101
  • cpanel.anakdurhaka-kamu
  • cpanel.anaksmaviral2022
  • cpanel.anjaywfy12
  • cpanel.anzhink6
  • cpanel.apple-en
  • cpanel.appser-appewsrgcvrew
  • cpanel.argan
  • cpanel.asuuuuuiyaaaaaa
  • cpanel.auth-idsessionsupportinfoshop
  • cpanel.auth01-securv1
  • cpanel.auth08a
  • cpanel.auth5-3secure
  • cpanel.authasecure822
  • cpanel.authnetflxpayu3
  • cpanel.authsecure-coinbase
  • cpanel.awek-melayunakal
  • cpanel.aws-console-recoveryy
  • cpanel.azserasxca
  • cpanel.b0oa
  • cpanel.bagibagi-bundelgratis2022
  • cpanel.bagibagijeckpot2022
  • cpanel.bandle-tersembunyi-resmi-garenaff-se-ke1
  • cpanel.bbvy
  • cpanel.bcrotctr
  • cpanel.bemsa
  • cpanel.bendelfreefiregratis
  • cpanel.berbagai-ituindah-2021
  • cpanel.berbagi-vidio
  • cpanel.bersindalamkamar
  • cpanel.besoul1
  • cpanel.betengampun
  • cpanel.bigbosallskin
  • cpanel.bokep-virall627
  • cpanel.booyah-contoh5
  • cpanel.booyahffmax
  • cpanel.box-biru-new-garena-7
  • cpanel.bpajnxowma
  • cpanel.broken-domain
  • cpanel.bug-event-codashop-id-2021
  • cpanel.bug-yinyang122
  • cpanel.bundlegratis-freefire21
  • cpanel.bvcxszowa12
  • cpanel.c1ti23inauthinfo
  • cpanel.cc35397632b72479a085ebc680b0220f
  • cpanel.cd43z-p6skay4x-4tx
  • cpanel.cek-sc-lordagilxyz
  • cpanel.ch-authnc1
  • cpanel.chaseo
  • cpanel.chaseonline-idv
  • cpanel.chat-grupwhatsappviral22
  • cpanel.chat-whatsapp-com-grupindoxnxx
  • cpanel.chat-whatsapp-com717
  • cpanel.chatwhatsapp-gbsy
  • cpanel.chatwhatsappsex79
  • cpanel.citffx-1089
  • cpanel.citimobile-verified
  • cpanel.citizens01-sec1
  • cpanel.claim-allevo-vip
  • cpanel.claim-aniversary-ff2021
  • cpanel.claim-anniversary-2021
  • cpanel.claim-bundelgratis-garena20
  • cpanel.claim-bundleff12
  • cpanel.claim-create-ff-4820
  • cpanel.claim-event-bug-freefire636
  • cpanel.claim-event-codashop-gratis1
  • cpanel.claim-event-codashopp2022
  • cpanel.claim-event-ff1
  • cpanel.claim-event-gratis-45
  • cpanel.claim-event-kulgarr-gratiss1
  • cpanel.claim-eventff7738
  • cpanel.claim-freegarena83
  • cpanel.claim-freeskinml
  • cpanel.claim-hadiah-freefire-tahun2022
  • cpanel.claim-item-free-101010
  • cpanel.claim-item-freefire555
  • cpanel.claim-item-gratis753
  • cpanel.claim-item-terbaru-garena7366364
  • cpanel.claim-skin-terbaru-mlbb21
  • cpanel.claim-skinmlbb-fzhnim
  • cpanel.claim.eventff2021new
  • cpanel.claimcd.codaff-com
  • cpanel.claimclmfreeallitemfas2021com
  • cpanel.claimcobra267
  • cpanel.claimeventbudigamingdanfrontalskinbaju
  • cpanel.claimff205
  • cpanel.claimfre-skin
  • cpanel.claimfreefire-events2021
  • cpanel.claimhadaih2021
  • cpanel.claimhadiahdarigua
  • cpanel.claimhadiahdiamond-akhirtahun
  • cpanel.claimhadiahfreefire-com
  • cpanel.claimincubatorgratis2022
  • cpanel.claimitemff-freenews1
  • cpanel.claimm-event-resmi-garena
  • cpanel.claimseson1disini
  • cpanel.claimskin92838
  • cpanel.clam2022-venom
  • cpanel.click-discov
  • cpanel.clim-itemold2021
  • cpanel.coba-dulu
  • cpanel.cobaaku-paham
  • cpanel.coda-claimgratis-2021-33
  • cpanel.coda-shop213
  • cpanel.coda-shopff-gratiss2022
  • cpanel.coda-shopp-freefire
  • cpanel.codahopgamesreal
  • cpanel.codahsop-gartis-2022
  • cpanel.codashoop-76
  • cpanel.codashop-allgame-2021
  • cpanel.codashop-event673
  • cpanel.codashop-eventgratis-resmi
  • cpanel.codashop-freefire-7
  • cpanel.codashop-freefire776
  • cpanel.codashop-freez1
  • cpanel.codashop-garena12
  • cpanel.codashop-gratis-132
  • cpanel.codashop-gratis1927
  • cpanel.codashop-gratis41
  • cpanel.codashop-juli25
  • cpanel.codashop-topup-free22
  • cpanel.codashop-ygy
  • cpanel.codashop.untk.freefiregratis1
  • cpanel.codashopbug-2021
  • cpanel.codashopeventvip10
  • cpanel.codashopfreefireclaimdm
  • cpanel.codashopvc4
  • cpanel.codashopx18
  • cpanel.codasopgeratis
  • cpanel.codaterbaru
  • cpanel.coinbased-costumer
  • cpanel.connect-wells2user
  • cpanel.connect4secure
  • cpanel.connect8c-verify-netflix
  • cpanel.connectviate03
  • cpanel.contohwhm
  • cpanel.create-valdtaionsonline
  • cpanel.creatff9
  • cpanel.ctz-2223131
  • cpanel.ctznsz-user-verification-security-05s
  • cpanel.curux
  • cpanel.customer-appverify
  • cpanel.daftar-advanced-ff2022
  • cpanel.dashboard3ps2bv2tboi-hellp365me
  • cpanel.dawdskahkdnwahd-dajkdsbckaj
  • cpanel.demopoxpid
  • cpanel.dereinolo
  • cpanel.dhlservice
  • cpanel.diamond-gratis-disini-778
  • cpanel.diamond-mobilelegends-gratis-2021
  • cpanel.diamondfree8839.eventff6788
  • cpanel.dimanakah-saritem
  • cpanel.discover-services
  • cpanel.dks2464
  • cpanel.dm-ml-gratis2021
  • cpanel.dronerl
  • cpanel.dscodashppml
  • cpanel.dylandprosbagibagihadiahfreefire
  • cpanel.dyyn
  • cpanel.e-sport-turnamen
  • cpanel.e8a141eeeb256dde245ef3bf257d8abe
  • cpanel.ecmtt
  • cpanel.edd2secur4verif
  • cpanel.efent-ff-tzy
  • cpanel.efsr-server
  • cpanel.ekal-store-website
  • cpanel.emal
  • cpanel.ethlivetestt
  • cpanel.even-diamondgarena
  • cpanel.even-freefire-september
  • cpanel.even-mobile-legend-claim152
  • cpanel.evencodashopgratis
  • cpanel.event-claim-ff27
  • cpanel.event-claimlootcrate-new2021
  • cpanel.event-coda-gratis928
  • cpanel.event-coda-shop2022
  • cpanel.event-codashop-free9
  • cpanel.event-creat-gratis
  • cpanel.event-event-ff
  • cpanel.event-ff--claim-gratis--2021
  • cpanel.event-free-fire-juli2021
  • cpanel.event-freefire-2021-new
  • cpanel.event-freefire-batleground
  • cpanel.event-freefire-bundle-incubator
  • cpanel.event-freefire-gratis-garenaindonesia
  • cpanel.event-freefire-terbatas-terbaru
  • cpanel.event-freefire343
  • cpanel.event-freefire918
  • cpanel.event-garena-free-fire-tanggal-27
  • cpanel.event-gerena-freefiree11
  • cpanel.event-item-old-darigarena
  • cpanel.event-kulgar8173
  • cpanel.event-ml90
  • cpanel.event-mlbb277
  • cpanel.event-resmi-bulanjuni2021
  • cpanel.event-resmi-garena1201
  • cpanel.event-resmi-garens
  • cpanel.event-skin-ff-des
  • cpanel.event-spin-ff17
  • cpanel.event-spin-ff657
  • cpanel.event-spin7k
  • cpanel.event-tahunbaru-dylanpross2022
  • cpanel.eventcobraa-xfreefire21o
  • cpanel.eventcodashop-viral2022
  • cpanel.eventffcoy
  • cpanel.eventffmax2022
  • cpanel.eventffterbaru-garena
  • cpanel.eventfreefireterbaru-2022
  • cpanel.eventfreefireterbaru01
  • cpanel.eventgarenafreefire-terbaru2021
  • cpanel.eventgfreefirent
  • cpanel.eventgratis-freefire-72021
  • cpanel.eventlootcrate.freegetitem51
  • cpanel.eventmllbnew
  • cpanel.eventnews89
  • cpanel.eventspin56
  • cpanel.eventtopup.al-stars
  • cpanel.f.fvnntt
  • cpanel.fantosh
  • cpanel.ff-bagibagihadiah
  • cpanel.ff-codasv
  • cpanel.ff-garena-2022
  • cpanel.ff-gratis-claim-event67
  • cpanel.ffbundle-free207
  • cpanel.ffcodashope
  • cpanel.ffeventgratis-23
  • cpanel.ffgarenagege
  • cpanel.ffgets277
  • cpanel.ffmax-event-tersembunyi2021
  • cpanel.ffnlspn2022
  • cpanel.fire-claim-spin
  • cpanel.flj31nb9om0cw6u28s
  • cpanel.free-diamond-resmi-codashop773
  • cpanel.free-domino-2021
  • cpanel.freecrete-ffnews16
  • cpanel.freeeventclaims-newsclaims1
  • cpanel.freefire-eventclaim-free999
  • cpanel.freefire-eventseptember
  • cpanel.freefire-newevents999
  • cpanel.freefireclaimgratis123
  • cpanel.freefiree999
  • cpanel.freefireeventtnew
  • cpanel.freefirenewevent1
  • cpanel.freefireshopz21
  • cpanel.freespin-bykulgarindonesia
  • cpanel.frefireevent00
  • cpanel.fullnontongrupwa7
  • cpanel.fw3z7gh-90px4p0-a63z
  • cpanel.fypttfatik
  • cpanel.gabung-vip
  • cpanel.gabunggrupnewviral8
  • cpanel.garena-event-freeclaim-04
  • cpanel.garena-ffterbaru-2021p
  • cpanel.garena-freefire345
  • cpanel.garena-giveaway2022
  • cpanel.garena-giveaway23
  • cpanel.garenaboyaah
  • cpanel.garenaevent34
  • cpanel.garenaevntt68
  • cpanel.get-diamond-free-now
  • cpanel.giveaway-moonton2
  • cpanel.giveaway-moonton4
  • cpanel.goodf
  • cpanel.gratis-event-2021-comid
  • cpanel.gratis.freefire-diamond2021
  • cpanel.gratistopup1
  • cpanel.groubwhatsappbokepviral
  • cpanel.group-whatsapp18-terbaru555
  • cpanel.groupwa18
  • cpanel.grub-whatsapp528
  • cpanel.grubchika18-2022v-1
  • cpanel.grubdesah-viral2022
  • cpanel.grubwhatsapawekmalay
  • cpanel.grup-bokep185
  • cpanel.grup-private22
  • cpanel.grup-whatsapp-viral-hot16
  • cpanel.grupcukgaming17
  • cpanel.grupnotnot.joinsini
  • cpanel.grupp-simmontokk18-dewass
  • cpanel.gruptante2022
  • cpanel.grupviral23detikk
  • cpanel.grupvlral-18
  • cpanel.grupwa-virall99
  • cpanel.grupwafullnonton17
  • cpanel.grupwhatssappindoviral18terbaru
  • cpanel.gurita-kota
  • cpanel.gwwt9ucnvc3pqxeqifpxvv
  • cpanel.hadiah-dari-dyland-pross-2021
  • cpanel.hadiahfreefire-123
  • cpanel.haha-hayyy
  • cpanel.happiest-words
  • cpanel.hdfullnihh
  • cpanel.help-beccu02
  • cpanel.helptruistechhub
  • cpanel.hepl-securitas
  • cpanel.higgsdominofree
  • cpanel.hnhmart
  • cpanel.home03c8-bderty
  • cpanel.homepageserv10
  • cpanel.howenbara
  • cpanel.hp2q1cu61rs
  • cpanel.huntington-onlines
  • cpanel.ibnu-eventjb999
  • cpanel.ids0
  • cpanel.ijogkyo-hm
  • cpanel.ika2020
  • cpanel.ilcoinbase
  • cpanel.infoocheckmy7890
  • cpanel.informatiobiling-paaypal-serveic
  • cpanel.instutett
  • cpanel.iogon-members1st-fcu1
  • cpanel.ishaku
  • cpanel.itempesnow
  • cpanel.iy3gu3tau
  • cpanel.jasteb-luckystrx
  • cpanel.jesssnolimit
  • cpanel.join-grup-hot-whatsapp
  • cpanel.join-grup-kaka-yahh
  • cpanel.join-grup-tante166
  • cpanel.join-wa18hot
  • cpanel.joingrupdewasa-terbaru234
  • cpanel.joingrupwaid21
  • cpanel.joingrupyukkguyss
  • cpanel.joinguysyuk.domgrub
  • cpanel.kamangalaiko
  • cpanel.karekayenamenang
  • cpanel.keneredsilk88
  • cpanel.kentotottt
  • cpanel.kerupuk-udang
  • cpanel.kinyaioska
  • cpanel.kjehwfkrhwf
  • cpanel.klaim-item-garena
  • cpanel.klaimevent-garena
  • cpanel.klaimffws0
  • cpanel.klaimhadiahff12
  • cpanel.kmmy15
  • cpanel.kontolmamakkaupecah40-698943-dfgnhfd
  • cpanel.kore3-xkasnfkasjansf
  • cpanel.kuclekek
  • cpanel.kukuncratan
  • cpanel.kulgar-qoqkw
  • cpanel.kuwshdc0d-238d023
  • cpanel.lambilakunffgratis
  • cpanel.lasbahamaspempresas
  • cpanel.likespesialmei
  • cpanel.linkfulljavhdhd
  • cpanel.lnformations-amaz0n-srvcs
  • cpanel.lucky-freefire2021
  • cpanel.lucky-spin-gratis61
  • cpanel.luckycrate-75
  • cpanel.luckyroyal-frontal
  • cpanel.luckyspin-resmi-freefire-garena9diamond
  • cpanel.luckyspinx18
  • cpanel.lukyclam83
  • cpanel.lyvaah9jb-hl3dxezan-fecxbnk9
  • cpanel.manag9ex-access8fd-b0ak-7ach
  • cpanel.maskencukaya
  • cpanel.masterjayjay125
  • cpanel.math01-scisence01-inf
  • cpanel.media-firepramuka-viral
  • cpanel.mediafire-viralchrishisoka
  • cpanel.memq2
  • cpanel.mertskadiya
  • cpanel.midas-realll-free-uc-claim-noww
  • cpanel.midasbuy-free
  • cpanel.mimiemail
  • cpanel.mistery.eventcobragratis
  • cpanel.mlbb-eventfree
  • cpanel.mlbb-joins39
  • cpanel.mlbbclam-skin2022
  • cpanel.mlbbnew86
  • cpanel.mlbbskin2021stunt
  • cpanel.mlsecurecltl
  • cpanel.moco-store-gratis28468
  • cpanel.mod-game-hdi
  • cpanel.movingnetmoviesadminflix
  • cpanel.mt1page
  • cpanel.mtb-tsecs
  • cpanel.mtbaffects
  • cpanel.mtbbanking03
  • cpanel.mtgbsseuverif
  • cpanel.mutd7gfra1pdx6irsthf
  • cpanel.myxl2
  • cpanel.n3flkix
  • cpanel.neonstore
  • cpanel.netlinkedupdatedirectory00
  • cpanel.new-spin-ak37
  • cpanel.newclaimeventgaranr
  • cpanel.newclamitemggz8
  • cpanel.newmember1408
  • cpanel.news3eventgarenq
  • cpanel.nfcu-bankaccount
  • cpanel.nfsecur-11usid
  • cpanel.ngsa2
  • cpanel.niccko9serv
  • cpanel.nonton-vidio-bokepvirall-2022
  • cpanel.nontonbokepsepuasnya7hf
  • cpanel.noreplycitis
  • cpanel.nuverpip-cofesgo
  • cpanel.nwwyhevetgrppw
  • cpanel.nyovamasos0w
  • cpanel.officdedek
  • cpanel.okepgege2022
  • cpanel.okepgegee
  • cpanel.okepviral18
  • cpanel.okepviraljepang18
  • cpanel.online-chasertey
  • cpanel.online-seucre09v
  • cpanel.onlinecuato
  • cpanel.order2062012
  • cpanel.order495600
  • cpanel.ouch8
  • cpanel.page-officekont0l
  • cpanel.pageaccountcoinbasenow
  • cpanel.pageserviceuser1
  • cpanel.panel-gajahmadahv2
  • cpanel.panelhrays
  • cpanel.payp4i
  • cpanel.penaklakenen
  • cpanel.pepepekuzjsi-wiasjdsjjdbsfsdjfsdjuyresjh
  • cpanel.peringantan-facebook-terblockir
  • cpanel.pesmobilefreecoin2021
  • cpanel.pesnewvenet2022
  • cpanel.piipsdc-token-true-id
  • cpanel.pinjaman-online
  • cpanel.plhjgf76gyggy
  • cpanel.popomy
  • cpanel.ppn10
  • cpanel.primembershiparenewalli
  • cpanel.pubgitems11
  • cpanel.pupung-sasimita2021
  • cpanel.redirect-citiznsauthaverfiyinfomation
  • cpanel.redirect-secure-rb
  • cpanel.redirectiing-webma
  • cpanel.remi-event-gratis.freefire-event-gratiss009
  • cpanel.renewall-mernbershippae
  • cpanel.reqions07
  • cpanel.resolutionproblem-xfinity
  • cpanel.result01
  • cpanel.rorojokan
  • cpanel.rulstore
  • cpanel.s-53
  • cpanel.safeaccteam-286
  • cpanel.sawan-budakna
  • cpanel.sceure-becu-inf0
  • cpanel.se3verxxuser
  • cpanel.sec-ibxkey
  • cpanel.sec-mtbserv3
  • cpanel.secr-0123
  • cpanel.secre3e0verif7y-redirect3008
  • cpanel.secure-53
  • cpanel.secure-afcu
  • cpanel.secure-moneylion
  • cpanel.secure-netverify-chaseupdate
  • cpanel.secure-payment-accounts-net
  • cpanel.secure-quth701
  • cpanel.secure003c-verify-account-login
  • cpanel.secure007deatails88
  • cpanel.secure02-netflixverify
  • cpanel.secure07b-panel-home1
  • cpanel.secure09c-useronline
  • cpanel.secure0a-saf3lognn
  • cpanel.secure21-acct
  • cpanel.secure2d-truist7-9access7
  • cpanel.secure404user
  • cpanel.secure98kverify
  • cpanel.secured-suo-verificate
  • cpanel.securehub-cltlreview
  • cpanel.securelyverifyme-0923s
  • cpanel.secureup1l9rverify
  • cpanel.security1-data44
  • cpanel.sedih-akumah
  • cpanel.ser3ice-06b0a-0nline
  • cpanel.serv-dablagboti
  • cpanel.serv01consumer
  • cpanel.server1-amazn
  • cpanel.servic473
  • cpanel.service-problems-konto-management-de
  • cpanel.service0-verify
  • cpanel.servicecspp67827
  • cpanel.servicecssam496879
  • cpanel.serviceskylineaccountyy
  • cpanel.sewaresss
  • cpanel.shieldm-ypersonaindetaiil
  • cpanel.shortdp
  • cpanel.signinewuvs0h1sc
  • cpanel.simontok-terbaru-maret-77-2022
  • cpanel.simontok778
  • cpanel.simontok918
  • cpanel.simontoknew-websitebokep2022
  • cpanel.sjjsndjansjsnd
  • cpanel.smkviraldiperkosa
  • cpanel.smntkkkt.18plusstn
  • cpanel.smtp-iruldanoreky
  • cpanel.solveu
  • cpanel.sonngz-xyz
  • cpanel.span5
  • cpanel.spin-bundleff-resmi-darigarena2021
  • cpanel.spin-gratis258
  • cpanel.spin.spin-itemfflangkah
  • cpanel.spinfree-2021
  • cpanel.spinroyale-agustus17
  • cpanel.srvcs-intliamzaccountpay
  • cpanel.strinfo-applied-prchsrv
  • cpanel.sub-evnt19
  • cpanel.subdohost
  • cpanel.subdomain-rifkyhost-2022
  • cpanel.syrianghozy
  • cpanel.systm-eupdt
  • cpanel.tantemuda-grupwhtsapp
  • cpanel.technicalinfo02n-levelcode5
  • cpanel.terbaru-resmi-garena2022
  • cpanel.testing-cash
  • cpanel.testpagestest
  • cpanel.testwebs
  • cpanel.tigabelaempatbelas87110
  • cpanel.titid
  • cpanel.token-c88762j
  • cpanel.tontonsexwhatsap23
  • cpanel.topup-ffmaxcodashop
  • cpanel.topup-gratis-codashop2022
  • cpanel.truistdais07banking
  • cpanel.trulst-auth
  • cpanel.ttesssst
  • cpanel.turinfo.vipdarkhost-xyz
  • cpanel.unipin2021
  • cpanel.update-account-secure01b-chase-online
  • cpanel.updatesaccwebs-authdbillsecureds
  • cpanel.userdesk-serv047
  • cpanel.usermandate
  • cpanel.uslfy2lshabvfcu49i22
  • cpanel.uspsy6yuverif
  • cpanel.veri0wellsfargo
  • cpanel.verificnowww
  • cpanel.verifiedcitizens
  • cpanel.verifty-settrobin
  • cpanel.verify-cashapp
  • cpanel.verify-paymentmembershipamazon
  • cpanel.verify145
  • cpanel.verify6b-netflix
  • cpanel.verifyitfullysecureasdjf02s-sj23
  • cpanel.verifysepcume
  • cpanel.video-0-2021
  • cpanel.video-terbaru2021
  • cpanel.video-viral-terbaruhot2022
  • cpanel.video-viral2021s
  • cpanel.video-xxx-smp
  • cpanel.videodewasaidn
  • cpanel.videovips67
  • cpanel.videoviralvcs66
  • cpanel.videoviralvcs73
  • cpanel.vidiobokep-gurudanmuridviral
  • cpanel.vidioviral19terbaruhot
  • cpanel.vip-youclaimfree071
  • cpanel.viral-grupnew
  • cpanel.viral-mediafire-terbaru4
  • cpanel.viral-new54
  • cpanel.viralbkp2021
  • cpanel.w3llunited
  • cpanel.wallets-kontolcina
  • cpanel.wd-coinbsesuppmailea
  • cpanel.we-solutions-accounts
  • cpanel.wellsfarg000
  • cpanel.wellsomobago
  • cpanel.wfsec009
  • cpanel.wfsecureserver
  • cpanel.whatsapp786
  • cpanel.whatsappberbagiviral
  • cpanel.whatsappgroupinvitejoinowgrup27
  • cpanel.whatsappgroupinvitejoinowgrupjoinnow88
  • cpanel.whatsappwkbcxzjvc
  • cpanel.whatshapinvite18
  • cpanel.winning-lottery
  • cpanel.withrfcntg
  • cpanel.wrthma
  • cpanel.wuw2
  • cpanel.wwwhadiahffgratis2022
  • cpanel.wwwscurmyaccount
  • cpanel.x-z
  • cpanel.x2myif7w1fxkac
  • cpanel.xxx-v
  • cpanel.yygggfxixx
  • cpanel.zsupport
  • cpaypal-co-frde-mailapps-7
  • cpcalendars.000002415627
  • cpcalendars.000544140104
  • cpcalendars.000965475
  • cpcalendars.0087866013
  • cpcalendars.00988206
  • cpcalendars.0112776120
  • cpcalendars.014785204311
  • cpcalendars.0192013551
  • cpcalendars.021010018
  • cpcalendars.021118417
  • cpcalendars.0215406
  • cpcalendars.02202202210
  • cpcalendars.030201659429
  • cpcalendars.0440201
  • cpcalendars.0654836215516
  • cpcalendars.0701201256
  • cpcalendars.07847559
  • cpcalendars.0rv
  • cpcalendars.100000121101
  • cpcalendars.1000234983953
  • cpcalendars.1000234984070
  • cpcalendars.1000234984144
  • cpcalendars.1000234984633
  • cpcalendars.1000234984859
  • cpcalendars.1000234985234
  • cpcalendars.1000234985685
  • cpcalendars.1000234985710
  • cpcalendars.1000384576315
  • cpcalendars.10021123416
  • cpcalendars.100308226405
  • cpcalendars.10036270909
  • cpcalendars.100446458303
  • cpcalendars.10049610505
  • cpcalendars.100529267919
  • cpcalendars.100588918911
  • cpcalendars.100725081405
  • cpcalendars.100814811507
  • cpcalendars.100833161918
  • cpcalendars.100895035909
  • cpcalendars.10099150513
  • cpcalendars.1011134983732
  • cpcalendars.1011134984370
  • cpcalendars.1011134984579
  • cpcalendars.1011134984623
  • cpcalendars.1011134984842
  • cpcalendars.101258618819
  • cpcalendars.101395099319
  • cpcalendars.101842469512
  • cpcalendars.102134025820
  • cpcalendars.102237815511
  • cpcalendars.102521912419
  • cpcalendars.10274464818
  • cpcalendars.103201251806
  • cpcalendars.103329211416
  • cpcalendars.103390812720
  • cpcalendars.103549211411
  • cpcalendars.103567281313
  • cpcalendars.10364527119
  • cpcalendars.103674442616
  • cpcalendars.103864936102
  • cpcalendars.10411956112
  • cpcalendars.104165762601
  • cpcalendars.104474814617
  • cpcalendars.104584445808
  • cpcalendars.104799844204
  • cpcalendars.104951737917
  • cpcalendars.104975221203
  • cpcalendars.104979859506
  • cpcalendars.10509186218
  • cpcalendars.105287557805
  • cpcalendars.10562834718
  • cpcalendars.10606432217
  • cpcalendars.106083135119
  • cpcalendars.106637635819
  • cpcalendars.106860928305
  • cpcalendars.10710962301
  • cpcalendars.10718407102
  • cpcalendars.107391772319
  • cpcalendars.107673308807
  • cpcalendars.10803057106
  • cpcalendars.108164752511
  • cpcalendars.108433768708
  • cpcalendars.108900363809
  • cpcalendars.109101143802
  • cpcalendars.109177278604
  • cpcalendars.10943139520
  • cpcalendars.109871240908
  • cpcalendars.110123654889
  • cpcalendars.110265995308
  • cpcalendars.110877278613
  • cpcalendars.110891178407
  • cpcalendars.111256328502
  • cpcalendars.112133
  • cpcalendars.112143240918
  • cpcalendars.112152163618
  • cpcalendars.112915241820
  • cpcalendars.1132210921
  • cpcalendars.113307387104
  • cpcalendars.11357891714
  • cpcalendars.113776743416
  • cpcalendars.114182624904
  • cpcalendars.114324254577
  • cpcalendars.115741093117
  • cpcalendars.116612451811
  • cpcalendars.11674358102
  • cpcalendars.117968513520
  • cpcalendars.118286327907
  • cpcalendars.121617820812
  • cpcalendars.12225905213
  • cpcalendars.122422894505
  • cpcalendars.12980045720
  • cpcalendars.13025192507
  • cpcalendars.13291202510
  • cpcalendars.13305957107
  • cpcalendars.13325764024
  • cpcalendars.143417209311
  • cpcalendars.145132752704
  • cpcalendars.146kuotagratis
  • cpcalendars.153462559815
  • cpcalendars.1535159
  • cpcalendars.154551218892
  • cpcalendars.154551219226
  • cpcalendars.154551219313
  • cpcalendars.154551219720
  • cpcalendars.154551220144
  • cpcalendars.154551220275
  • cpcalendars.154551220491
  • cpcalendars.154551220769
  • cpcalendars.1561218919
  • cpcalendars.16310413508
  • cpcalendars.167289463417
  • cpcalendars.167467396215
  • cpcalendars.167477737901
  • cpcalendars.171404633308
  • cpcalendars.17498356111
  • cpcalendars.175865665716
  • cpcalendars.176672347310
  • cpcalendars.176672347318
  • cpcalendars.179428426508
  • cpcalendars.182992881720
  • cpcalendars.18503700605
  • cpcalendars.189354381716
  • cpcalendars.194481390501
  • cpcalendars.196138283717
  • cpcalendars.197018587313
  • cpcalendars.197301098912
  • cpcalendars.197995937220
  • cpcalendars.19802365987422
  • cpcalendars.1lvj2r-0003ne-hy
  • cpcalendars.1m6hxx-0003lx-2b
  • cpcalendars.1mcyt1-0003ao-7c
  • cpcalendars.1migdr-0006nn-cw
  • cpcalendars.1mkn2f-000854-iv
  • cpcalendars.1mnw5s-0001hm-1m
  • cpcalendars.1mrmai-0004gz-5z
  • cpcalendars.1n5ys7-0002cc-9n
  • cpcalendars.20071909
  • cpcalendars.20kuotagratis
  • cpcalendars.2122113209
  • cpcalendars.223432125
  • cpcalendars.23221434231238
  • cpcalendars.2341415
  • cpcalendars.24546543401010
  • cpcalendars.2456677030
  • cpcalendars.24796909513
  • cpcalendars.25231303
  • cpcalendars.255257395112
  • cpcalendars.256985692509
  • cpcalendars.26355015301
  • cpcalendars.264852209620
  • cpcalendars.269565846702
  • cpcalendars.2981136
  • cpcalendars.298285410303
  • cpcalendars.298285410310
  • cpcalendars.301948300407
  • cpcalendars.30user-0agent
  • cpcalendars.320306
  • cpcalendars.32109910238276
  • cpcalendars.3245245388
  • cpcalendars.3258794104
  • cpcalendars.3265478950
  • cpcalendars.3265478968
  • cpcalendars.331334974101
  • cpcalendars.3332312113
  • cpcalendars.33332224403
  • cpcalendars.3335628667905
  • cpcalendars.3343212
  • cpcalendars.336718303302
  • cpcalendars.34223161
  • cpcalendars.3432132415
  • cpcalendars.344343822817
  • cpcalendars.34436799502
  • cpcalendars.345307
  • cpcalendars.349912252517
  • cpcalendars.3532543893101
  • cpcalendars.353351891311
  • cpcalendars.35353643461
  • cpcalendars.35356534087258
  • cpcalendars.3544523273
  • cpcalendars.355182664405
  • cpcalendars.37737oooll000
  • cpcalendars.3789648732643230
  • cpcalendars.382166362106
  • cpcalendars.3hasgdkwyagkshdgwkja
  • cpcalendars.40170707916
  • cpcalendars.40710916208
  • cpcalendars.42435342412
  • cpcalendars.42500003486
  • cpcalendars.426576424511526
  • cpcalendars.4268318101
  • cpcalendars.43153326
  • cpcalendars.43536363225
  • cpcalendars.44098813214
  • cpcalendars.4444324568708
  • cpcalendars.4449994313
  • cpcalendars.447543791914
  • cpcalendars.44757535556
  • cpcalendars.45365225
  • cpcalendars.45423401059
  • cpcalendars.45423401568
  • cpcalendars.45423402050
  • cpcalendars.45423402524
  • cpcalendars.45423403092
  • cpcalendars.45423403134
  • cpcalendars.45423403235
  • cpcalendars.480062508608
  • cpcalendars.4smg
  • cpcalendars.5000369806
  • cpcalendars.50017688607
  • cpcalendars.50502456770
  • cpcalendars.5050908037
  • cpcalendars.5071619
  • cpcalendars.509811702401
  • cpcalendars.511384838920
  • cpcalendars.53426532329
  • cpcalendars.535475874623
  • cpcalendars.535475874655
  • cpcalendars.537113623115
  • cpcalendars.541163855916
  • cpcalendars.54434880518
  • cpcalendars.545646422
  • cpcalendars.54565316
  • cpcalendars.546373873654502
  • cpcalendars.546373873654506
  • cpcalendars.54915178519
  • cpcalendars.555245821236905
  • cpcalendars.5555555543319
  • cpcalendars.5555555554507
  • cpcalendars.55656562719
  • cpcalendars.562452442
  • cpcalendars.565710800103
  • cpcalendars.568413264404
  • cpcalendars.56874523233
  • cpcalendars.56974103698519
  • cpcalendars.5838474401
  • cpcalendars.5ifth3rdver1fy
  • cpcalendars.6000115525688608
  • cpcalendars.60021380
  • cpcalendars.6060660618
  • cpcalendars.62425931919
  • cpcalendars.624646424698
  • cpcalendars.6252436648
  • cpcalendars.63212478318
  • cpcalendars.6543217825
  • cpcalendars.6598762644815
  • cpcalendars.6625da0f-4d43-46c4-a887-1ae3ec35a3b2
  • cpcalendars.6668524566601
  • cpcalendars.666982315866916
  • cpcalendars.6677752
  • cpcalendars.668186749814
  • cpcalendars.66985869852508
  • cpcalendars.672740232817
  • cpcalendars.67505421901
  • cpcalendars.67505421911
  • cpcalendars.6784389075407
  • cpcalendars.698524567
  • cpcalendars.719965098309
  • cpcalendars.73189216213
  • cpcalendars.745633255517
  • cpcalendars.74569350
  • cpcalendars.76434356315
  • cpcalendars.7676556710
  • cpcalendars.7698453014
  • cpcalendars.774643221
  • cpcalendars.77465355
  • cpcalendars.7778562566939
  • cpcalendars.778965325658916
  • cpcalendars.77confirmation21required3server11connect
  • cpcalendars.7854445823605
  • cpcalendars.7864327
  • cpcalendars.78928263535709
  • cpcalendars.7896325487417
  • cpcalendars.78964236987711
  • cpcalendars.79797976706
  • cpcalendars.7krha9wb8jtl
  • cpcalendars.800010033300688603
  • cpcalendars.800055265256688613
  • cpcalendars.800439167
  • cpcalendars.801522222225886626
  • cpcalendars.801522222225886633
  • cpcalendars.802215426100688602
  • cpcalendars.80741028603
  • cpcalendars.807590033
  • cpcalendars.80818218
  • cpcalendars.8110000238200
  • cpcalendars.8110000238486
  • cpcalendars.823987667903
  • cpcalendars.833826421506
  • cpcalendars.8372460058
  • cpcalendars.8414111141
  • cpcalendars.852434
  • cpcalendars.8764287655
  • cpcalendars.876543456607
  • cpcalendars.876687610
  • cpcalendars.87965413405
  • cpcalendars.882618
  • cpcalendars.882703
  • cpcalendars.88secure0service5confirm6alert5secure4se
  • cpcalendars.8916216508
  • cpcalendars.89632154703
  • cpcalendars.89654237854615
  • cpcalendars.89657456983412
  • cpcalendars.896574632520
  • cpcalendars.898875566
  • cpcalendars.89889129
  • cpcalendars.8m9t10bview
  • cpcalendars.8vcd26snp8
  • cpcalendars.90021395463
  • cpcalendars.90289417
  • cpcalendars.9090802029
  • cpcalendars.96321487503
  • cpcalendars.96875740307
  • cpcalendars.976774581
  • cpcalendars.984951651651918
  • cpcalendars.9856781652316
  • cpcalendars.985698692
  • cpcalendars.986565410
  • cpcalendars.98742169407
  • cpcalendars.987564796519
  • cpcalendars.9900234
  • cpcalendars.9981201022
  • cpcalendars.9988775675
  • cpcalendars.999658423585929
  • cpcalendars.aapp3847dssjdjja
  • cpcalendars.accessrecoverycebo3
  • cpcalendars.account-mtb
  • cpcalendars.account16-secured
  • cpcalendars.acessserver
  • cpcalendars.ada-yangmauvideocika
  • cpcalendars.addpack-bluestick
  • cpcalendars.adobereader-outlook
  • cpcalendars.advent-server-garena-freefir
  • cpcalendars.aj-bape
  • cpcalendars.alert-alaskaccu8
  • cpcalendars.allahisreal7
  • cpcalendars.alloperatosgratisindosat2023
  • cpcalendars.amazon-membership-primeupdates
  • cpcalendars.amazon-signin-871sabtu21-176
  • cpcalendars.amazon-signin-871selasa21-172
  • cpcalendars.amazon-signin-871sella1-162
  • cpcalendars.amazon-signin-87k4m11-109
  • cpcalendars.amazon-signin-cgaktaudirieput-158
  • cpcalendars.amazon22helpdesk
  • cpcalendars.amazonaccount-servicecentre029
  • cpcalendars.amazonverifysecureapp28893
  • cpcalendars.ambil-bundel-old-2021
  • cpcalendars.ambil-diamomd-gratis
  • cpcalendars.ambil-eventgratisff39
  • cpcalendars.ambil-hadiah-nya-event-terbatas
  • cpcalendars.ambil-hadiah-sekarang2022
  • cpcalendars.ambil-webff2021
  • cpcalendars.ambil.ambil-hadia
  • cpcalendars.amerfcu-ser-online
  • cpcalendars.amzdanzoxpxc11
  • cpcalendars.amzn-signin-871mkv247
  • cpcalendars.amzn-signin-p0c0ngx124
  • cpcalendars.amzon-signin-8194mrvls273
  • cpcalendars.amzonmomentcontacsupwork
  • cpcalendars.apphelplearntoedit
  • cpcalendars.appleidverifi
  • cpcalendars.ashketc11
  • cpcalendars.asiavideotaiwan90
  • cpcalendars.attivapsd2-gruppolsp
  • cpcalendars.auth-feedback21-amzn
  • cpcalendars.auth-idsessionshopinsecureacinformant
  • cpcalendars.authorize-user-id
  • cpcalendars.authverifyc1tisecure02e
  • cpcalendars.authverifyconnectbc3
  • cpcalendars.avoided-contagious
  • cpcalendars.awdasdc
  • cpcalendars.axvin4
  • cpcalendars.b-o-k-e-p-v-i-r-a-a-l-com
  • cpcalendars.babtyt44231frm
  • cpcalendars.bacotluanjingggggggg
  • cpcalendars.bankofamericamobile
  • cpcalendars.banyakbokepygviral
  • cpcalendars.becu-supportfo
  • cpcalendars.becu01org
  • cpcalendars.becuorghelp
  • cpcalendars.bellco-sec101
  • cpcalendars.bgmom5
  • cpcalendars.bokep-terbaru0919
  • cpcalendars.bokep-viral163
  • cpcalendars.bokep-viralgrup
  • cpcalendars.bokepindonesia2022
  • cpcalendars.bokepindoterbaru22-viral
  • cpcalendars.bokeplivechatnew
  • cpcalendars.bokepppterbaru
  • cpcalendars.bokepviral981
  • cpcalendars.bokkkep1234
  • cpcalendars.botverificationforsafe
  • cpcalendars.bpumbri
  • cpcalendars.brimo-tarif-terkini
  • cpcalendars.buruanjoin-viral
  • cpcalendars.c0d4-new-gam3
  • cpcalendars.c0nn3c7swebserv1ce
  • cpcalendars.chase05-ver
  • cpcalendars.chase5s8855
  • cpcalendars.chat-whatsaapp
  • cpcalendars.chat-whatsapp-grup2invite
  • cpcalendars.chatvcsnakal33
  • cpcalendars.chodashop-freefire-2022
  • cpcalendars.chuspsver
  • cpcalendars.citiverify-login
  • cpcalendars.citizenauthsecured
  • cpcalendars.citizeninnfo-4-efs
  • cpcalendars.citizens-secure07b-account-verification
  • cpcalendars.citizensbankonlineauth08
  • cpcalendars.citze-support
  • cpcalendars.ckwjmbbnapdtporypte6
  • cpcalendars.cla1m-itemff
  • cpcalendars.claim-bundlecobra123
  • cpcalendars.claim-carte-terbaru-2021
  • cpcalendars.claim-cobraff890
  • cpcalendars.claim-diamond-freefire-februari
  • cpcalendars.claim-diamond-gratis-18
  • cpcalendars.claim-event-ff-desember2
  • cpcalendars.claim-event-terbaru19
  • cpcalendars.claim-eventfreefireid
  • cpcalendars.claim-eventnotnot18
  • cpcalendars.claim-events2021
  • cpcalendars.claim-ff-hadiah01
  • cpcalendars.claim-hadiah-ffmax202
  • cpcalendars.claim-hadiah-grana1
  • cpcalendars.claim-hadiah-gratis-andragz
  • cpcalendars.claim-hadiah-gratis-ff-19
  • cpcalendars.claim-hadiah-item
  • cpcalendars.claim-item-ff-terbaru-2021-garena
  • cpcalendars.claim-item-old09
  • cpcalendars.claim-itemffgg7
  • cpcalendars.claim-mlbb58
  • cpcalendars.claim-skimfreefire
  • cpcalendars.claim-skin-free-mlbb
  • cpcalendars.claim-skin-legend-new-mlbb
  • cpcalendars.claim-skinmlgg2022
  • cpcalendars.claim-undian-ff9022
  • cpcalendars.claim.claim-itemruok
  • cpcalendars.claimdiamond-freefire-resmi
  • cpcalendars.claimdiamond-gg2021
  • cpcalendars.claimeventinfo
  • cpcalendars.claimeventnew-efp2021
  • cpcalendars.claimeventnew-garenaff2k21
  • cpcalendars.claimgarenafreefirexvenommm
  • cpcalendars.claimgarenaid
  • cpcalendars.claimhadiahgratisff281
  • cpcalendars.claimhadiahgratisresmigarena-2021
  • cpcalendars.claimhadiahini.bigevent-ff
  • cpcalendars.claimitem-ff-oldgratis71
  • cpcalendars.claimitem-ffgrtis28
  • cpcalendars.claimitem-freefire-2021
  • cpcalendars.claimitem-freefireofficial
  • cpcalendars.claimitemlangkagarenaff
  • cpcalendars.claimitemold12
  • cpcalendars.claimloot-freefire2022
  • cpcalendars.claimredff-vip
  • cpcalendars.clam-luckyspinnnew11
  • cpcalendars.clientasisst-pagemanage174
  • cpcalendars.cobaajanyamask
  • cpcalendars.cobatestginiajadeh1
  • cpcalendars.coda-garena-shop
  • cpcalendars.coda-new-100
  • cpcalendars.coda2.event-bulanan
  • cpcalendars.codaimond-vip669
  • cpcalendars.codashoopid0
  • cpcalendars.codashop-allgame55
  • cpcalendars.codashop-bangbudi01
  • cpcalendars.codashop-btw
  • cpcalendars.codashop-event-free-all-diamond
  • cpcalendars.codashop-eventgarena991
  • cpcalendars.codashop-ffkeren87
  • cpcalendars.codashop-freeevent21
  • cpcalendars.codashop-freefire08
  • cpcalendars.codashop-freev-ip11
  • cpcalendars.codashop-garena-gratis-22
  • cpcalendars.codashop-garena123
  • cpcalendars.codashop-garena678
  • cpcalendars.codashop-gratis-diamond21
  • cpcalendars.codashop-new-even
  • cpcalendars.codashop-pro-allgame2021
  • cpcalendars.codashop782
  • cpcalendars.codashop8917
  • cpcalendars.codashopbgid-event
  • cpcalendars.codashopeventreal145
  • cpcalendars.codashopgame211
  • cpcalendars.codasop-gg.claim-event-fire-free
  • cpcalendars.codgratisterbaruu
  • cpcalendars.codshop-promo
  • cpcalendars.codshopp-resmiii2021
  • cpcalendars.coinbase-accfdlck
  • cpcalendars.coinbzamqpp
  • cpcalendars.collcet-itemnew-vip1
  • cpcalendars.confirmationappssecuremail4213
  • cpcalendars.connect-welsfargo
  • cpcalendars.connectmail14
  • cpcalendars.connectverifysecure53b
  • cpcalendars.coodaashiop
  • cpcalendars.createauth96h-data4safe
  • cpcalendars.cumm-bkuniversal
  • cpcalendars.curlakwkwkk
  • cpcalendars.curlcacanihboss2022
  • cpcalendars.custimeramz-center
  • cpcalendars.cuts4
  • cpcalendars.cyberillinois
  • cpcalendars.dapatkan-bunddle-olld
  • cpcalendars.darry247
  • cpcalendars.daten-navigasi-kontos-de
  • cpcalendars.db125c26e5c95e6bff30f0a8c96a6464
  • cpcalendars.dbdbedbfnvds
  • cpcalendars.dedencodex22
  • cpcalendars.deskuser-clientservice0110
  • cpcalendars.diamondgratisdarigrenaterbaru
  • cpcalendars.diamont-free-gratis018
  • cpcalendars.dimasggparahcoy
  • cpcalendars.dnhl16
  • cpcalendars.dorokokok
  • cpcalendars.eccezzed2013-secured
  • cpcalendars.ed2321b72322a62d1197889626086c8e
  • cpcalendars.efootballfestivalevent
  • cpcalendars.efpfree-pes2021
  • cpcalendars.eke19556i9
  • cpcalendars.ernailvisindomain
  • cpcalendars.eugnhsjvbsilorjfjk
  • cpcalendars.even-garena-terbaru
  • cpcalendars.evendgarenanewgratis
  • cpcalendars.evens12021-55221
  • cpcalendars.event-besar-tahun-2022xz2
  • cpcalendars.event-claim76
  • cpcalendars.event-codashop125
  • cpcalendars.event-dari-ledta-garena
  • cpcalendars.event-ff6-com
  • cpcalendars.event-ffnew2
  • cpcalendars.event-free-fire-bagus-jelek-goblok
  • cpcalendars.event-freefire-garena-22
  • cpcalendars.event-freefire-gratis8393
  • cpcalendars.event-freefire591
  • cpcalendars.event-freefire722
  • cpcalendars.event-freefiregg0
  • cpcalendars.event-freegarena09
  • cpcalendars.event-garena-ff-5324
  • cpcalendars.event-garena-ff65
  • cpcalendars.event-garena-gratis391
  • cpcalendars.event-garenafreed9
  • cpcalendars.event-garenaspin91
  • cpcalendars.event-gratis-111
  • cpcalendars.event-gratis-coda36
  • cpcalendars.event-gratis-dari-garena74848
  • cpcalendars.event-gratis-ml-terbaru
  • cpcalendars.event-gratis187
  • cpcalendars.event-gratisan-dylanpros23
  • cpcalendars.event-gratiss-resmi-garena1
  • cpcalendars.event-lucky-spin-ff-terbaru
  • cpcalendars.event-moonton-7171
  • cpcalendars.event-resmi-ffid006
  • cpcalendars.event-specal51
  • cpcalendars.event-trueid-claim-free188
  • cpcalendars.event-vale-mlbb-gg
  • cpcalendars.event.coodashop4
  • cpcalendars.eventbugbundle17
  • cpcalendars.eventbulanramadhan
  • cpcalendars.eventbundle-oldclaim
  • cpcalendars.eventclaimm
  • cpcalendars.eventff889
  • cpcalendars.eventfreefire-free98
  • cpcalendars.eventgarenafreefiremaxkulgar
  • cpcalendars.eventgratisdarigarena01
  • cpcalendars.eventlootcreate-garena1
  • cpcalendars.eventmeigarena
  • cpcalendars.events-claim-hadiah-gratis2021
  • cpcalendars.eventterbarufreefire2021-8836
  • cpcalendars.eventtff-turgz
  • cpcalendars.eventtopcodashop
  • cpcalendars.evntprvtfrmmt
  • cpcalendars.expireorder2000242
  • cpcalendars.ez8pbsfc9rvvoseamuowqq
  • cpcalendars.f53d
  • cpcalendars.fb3261a7b65d525733e9a40065d3942c
  • cpcalendars.fdedcsfsdfvv
  • cpcalendars.fdgsfgsdffdgdfg1
  • cpcalendars.ff-anniversary1087
  • cpcalendars.ff-dm-gratis159
  • cpcalendars.ff-id14-com
  • cpcalendars.ff-max-gratis-ramdhan-2022
  • cpcalendars.ff-universary-new255
  • cpcalendars.ffevent-garenagratis-disini
  • cpcalendars.ffeventsgratisd
  • cpcalendars.ffevnt-claim1
  • cpcalendars.ffgratis-event-claim-item-old2021
  • cpcalendars.fitrianigrup
  • cpcalendars.forumpubg-event
  • cpcalendars.free-giveawayy
  • cpcalendars.free-skinff
  • cpcalendars.free.claimold-free
  • cpcalendars.freecoins-konami-event
  • cpcalendars.freediomomdallgame
  • cpcalendars.freeefireeeevetttt
  • cpcalendars.freefire-eventgratisnew
  • cpcalendars.freefire-garenen01
  • cpcalendars.freefire-spin233
  • cpcalendars.freefire2021-freeclaim-v1
  • cpcalendars.freefirecry
  • cpcalendars.freefiree-freecreat1
  • cpcalendars.freefireepep
  • cpcalendars.freefireeventbaru498
  • cpcalendars.freefireluckyyspinn
  • cpcalendars.freeget-eventgarena
  • cpcalendars.freemember793
  • cpcalendars.gabung-grup-tante-tante18
  • cpcalendars.garena-event-claim-bundleold21
  • cpcalendars.garena-event-gratis-2022
  • cpcalendars.garena-ffid-spesialevent
  • cpcalendars.garena-freeclaimx28
  • cpcalendars.garena-freefire-event-14
  • cpcalendars.garena-freefire-event72
  • cpcalendars.garena-riski-fasya
  • cpcalendars.garena-spin-update
  • cpcalendars.garenaeventspin-2021
  • cpcalendars.gerup.join-waa
  • cpcalendars.gewdcyuwegdt
  • cpcalendars.gncu-ld
  • cpcalendars.goalinsde
  • cpcalendars.goblok.subscrebchanelarif
  • cpcalendars.goyobod-segar
  • cpcalendars.gratisan-terbaru-eventfreefire10020
  • cpcalendars.group-viral-terbaru2022
  • cpcalendars.group-viral2022-com
  • cpcalendars.grouptanteviralhot
  • cpcalendars.grub-bokep-viral2022
  • cpcalendars.grub-tq-1827
  • cpcalendars.grubinvit2021
  • cpcalendars.grup-bokep-terbaru193
  • cpcalendars.grup-bokep-terbaru735
  • cpcalendars.grup-bokepzx-2022
  • cpcalendars.grup-khisus-dewasa
  • cpcalendars.grup-seleb-wahyukadeo1
  • cpcalendars.grup-viralhott
  • cpcalendars.grup-wa-hot1
  • cpcalendars.grup-whatsap-viral5678
  • cpcalendars.grupbkpjoinviralsc
  • cpcalendars.grupbokep-sma2022
  • cpcalendars.grupnew2021-20
  • cpcalendars.grupoke
  • cpcalendars.grupokepviiiralll-2022
  • cpcalendars.grupwhaatsap
  • cpcalendars.gtef5d7r
  • cpcalendars.hadaiheven-01
  • cpcalendars.hadiah-buat-kalian-dari-frostdiamond
  • cpcalendars.hadiah-bulan-aggustuss
  • cpcalendars.hadiah-codaa-terbaruu
  • cpcalendars.hadiah-darigarena-78
  • cpcalendars.hadiah-gratis-freefire-new-premium
  • cpcalendars.hadiah-gratis-freefire111
  • cpcalendars.hadiah-gratisdm
  • cpcalendars.hadiahhadiah
  • cpcalendars.hafizhhostingwebsite
  • cpcalendars.hahah-gree
  • cpcalendars.halloween-mlbb
  • cpcalendars.help-anidemasingan
  • cpcalendars.help-edd-security02
  • cpcalendars.help-securetmobileverify0980
  • cpcalendars.home-banca-nexi
  • cpcalendars.homepanel04
  • cpcalendars.hotvideofacebook
  • cpcalendars.husky09checking
  • cpcalendars.iamzyr
  • cpcalendars.indahnya-pemandangan
  • cpcalendars.info-serverrepair
  • cpcalendars.invit-grup-bokep-terbaru
  • cpcalendars.invoiceforyourorder
  • cpcalendars.itemffoldgarena
  • cpcalendars.ivent-garena667
  • cpcalendars.izatolil13
  • cpcalendars.japane
  • cpcalendars.javxxxkoreanhd
  • cpcalendars.join-grub-bokep-ahir-tahun2021
  • cpcalendars.join-grupwhatsapp5cc
  • cpcalendars.join-gruviralakuxx51
  • cpcalendars.joingroupwapapaphot
  • cpcalendars.joingroupwhatsap01
  • cpcalendars.joingrubaku15
  • cpcalendars.joingrubbokepsigitxgans
  • cpcalendars.joingrup-invit18
  • cpcalendars.joinzgroup-wazc
  • cpcalendars.jurus10
  • cpcalendars.k-my-bape
  • cpcalendars.kakehangnoloohipelidadimodarbaekirikce3
  • cpcalendars.kda1
  • cpcalendars.kecubung-009
  • cpcalendars.keyxdgkey
  • cpcalendars.klaim-free-fire-terbaru
  • cpcalendars.klaim-new-itemgratis251
  • cpcalendars.klik-event-terbaru
  • cpcalendars.kliksfreeevent-news8
  • cpcalendars.klikspecial-eventgarena1
  • cpcalendars.klim-hadiah-old23
  • cpcalendars.kontolgedepunyaelwx
  • cpcalendars.ktkuri10
  • cpcalendars.kulgar-byaja
  • cpcalendars.langasudahdenpaniangdiak
  • cpcalendars.laosfdystdf
  • cpcalendars.laplacedesmarches
  • cpcalendars.limamenut
  • cpcalendars.link-grubwa-ttante2022
  • cpcalendars.link-grup-hentai
  • cpcalendars.link-orang-deawasa18
  • cpcalendars.linkmediafire-terbaru990
  • cpcalendars.log-in-50504
  • cpcalendars.logauth-userinfo6
  • cpcalendars.login-755104
  • cpcalendars.loginnowamazonaccount
  • cpcalendars.luckdrawgratis-freefire
  • cpcalendars.lucky-spin-old-freefire-gratis
  • cpcalendars.luckyspin-2021garena
  • cpcalendars.luckyspin-gratis14
  • cpcalendars.luckyspinffgratis21
  • cpcalendars.lucxyspinffgratis25ins
  • cpcalendars.lukyspinff-ggterbaru-2021-9
  • cpcalendars.mack01
  • cpcalendars.macureset
  • cpcalendars.mail-helpdeskaccountupdatewebpage89101
  • cpcalendars.manage-accountverifyingform
  • cpcalendars.manehnekkamana
  • cpcalendars.mastmind056
  • cpcalendars.masuk-grub-bokep-semelekom188
  • cpcalendars.masukgrupku2022
  • cpcalendars.mediafirechika20
  • cpcalendars.mediafireviral01828291
  • cpcalendars.mediiafirechikaa2022
  • cpcalendars.mentas-walung
  • cpcalendars.microstoreaddy
  • cpcalendars.misterishop-gratis-oktober
  • cpcalendars.mlbb-event-free-skin
  • cpcalendars.mlbb-skin74
  • cpcalendars.mlbbevent21
  • cpcalendars.mlbbgamesz
  • cpcalendars.mnt-firm
  • cpcalendars.mobilelegends-event-2021
  • cpcalendars.mobilelegendsold2021
  • cpcalendars.mobilelegens-skin78
  • cpcalendars.modifydata6-insight2
  • cpcalendars.mtb-authverify
  • cpcalendars.murid-basith-nih
  • cpcalendars.mvcbndvmfvn
  • cpcalendars.my3nscec0u
  • cpcalendars.mysilver-strime
  • cpcalendars.mysubscription6324
  • cpcalendars.mywells
  • cpcalendars.mywellsfargo-help
  • cpcalendars.neifnioeniqe
  • cpcalendars.nemid-kontakt
  • cpcalendars.net-fl1xinternall
  • cpcalendars.netflixv9vsecure
  • cpcalendars.new-event.grup-mabar28
  • cpcalendars.newlucky-spin2021
  • cpcalendars.newshort
  • cpcalendars.newslogsinfofroms
  • cpcalendars.nfcu001secure
  • cpcalendars.nfsecuren2ysverify
  • cpcalendars.ngalanaonmaneh
  • cpcalendars.oawkoakwoa
  • cpcalendars.odlksnsktwo
  • cpcalendars.olwik2
  • cpcalendars.online-bonkfamclick
  • cpcalendars.online-citi-auths
  • cpcalendars.order1437514
  • cpcalendars.order475822
  • cpcalendars.orderaa1969026
  • cpcalendars.pagemember650098
  • cpcalendars.palpaldesdkfnmoasdifnaiopalpalde
  • cpcalendars.paypal-cardyou654
  • cpcalendars.paypalaccount-servicescentre002
  • cpcalendars.pdhikso
  • cpcalendars.pemulihanfacebook1
  • cpcalendars.peristiwa
  • cpcalendars.permsierasacciruask
  • cpcalendars.pesmobilefreecoin2021
  • cpcalendars.policysms-sender
  • cpcalendars.pornoindo70
  • cpcalendars.psaf9
  • cpcalendars.pubgsping
  • cpcalendars.pugbavzf-cutomerghbajzmabdsa
  • cpcalendars.qhas
  • cpcalendars.qsecurhqa
  • cpcalendars.qxy0nq87tov
  • cpcalendars.redirect34
  • cpcalendars.reeriksqw78236dj
  • cpcalendars.region-s
  • cpcalendars.restore-user00auth
  • cpcalendars.reward-claim-free
  • cpcalendars.rolspin-free
  • cpcalendars.s5tpmgcdsdt1t0fa6jtu
  • cpcalendars.salepoganteng
  • cpcalendars.samuraitrader
  • cpcalendars.scodexganteng
  • cpcalendars.scureaccount6379
  • cpcalendars.sdqlkjhkjsdhiw72dyiudhiushdw7uygdhkjsgds
  • cpcalendars.seaxzipo
  • cpcalendars.sec-afcu
  • cpcalendars.sec-mandt
  • cpcalendars.sec-ure-online-verificat-ion
  • cpcalendars.sec04auth-l0g
  • cpcalendars.secudr012-ntfx
  • cpcalendars.secur3-assistauthuser00
  • cpcalendars.secur3-client
  • cpcalendars.secur3d-r-b-f-c-u-veri5ed
  • cpcalendars.secur43jverifyauthssl
  • cpcalendars.securd2467-nfx
  • cpcalendars.secure-wells-online
  • cpcalendars.secure-withdrawal-account28762
  • cpcalendars.secure02portal
  • cpcalendars.secure09pnc-verification
  • cpcalendars.secure0as1c
  • cpcalendars.secure3d-amazon-accounts
  • cpcalendars.secure7uverify
  • cpcalendars.secureaccountsupport
  • cpcalendars.securechasereview
  • cpcalendars.secureu6fverify
  • cpcalendars.securewellafa
  • cpcalendars.security56-service
  • cpcalendars.serv-mailamz4
  • cpcalendars.server08-mitdxdy
  • cpcalendars.servic0021account
  • cpcalendars.servicecssam4165694
  • cpcalendars.servicecssam46201556
  • cpcalendars.servicecssam529
  • cpcalendars.settnginformation-amazonvalid
  • cpcalendars.sev-optnavyonline
  • cpcalendars.shorthash002
  • cpcalendars.sign-inreviewserver
  • cpcalendars.situs-dewasa-viral-terbaru1
  • cpcalendars.skinff-hdiahffay
  • cpcalendars.smntkpluss18
  • cpcalendars.spin-event-ini-real-kulgar12
  • cpcalendars.spin-gratis1299
  • cpcalendars.spin-hadiah-garena666
  • cpcalendars.spin-v2-claim
  • cpcalendars.spindayevent5
  • cpcalendars.spingratis136
  • cpcalendars.spingratisgarena22
  • cpcalendars.ssidssesai2
  • cpcalendars.stamnt-infoaccntlockedamazon
  • cpcalendars.su-region
  • cpcalendars.subsaccuntlgn-0019
  • cpcalendars.subsign-amazn
  • cpcalendars.summermlbb4
  • cpcalendars.sumontokressgg
  • cpcalendars.suncoast-fraud
  • cpcalendars.supp3-mta
  • cpcalendars.syjdyq9tv2
  • cpcalendars.systemmaintainanceoss
  • cpcalendars.tels-appmakamneyete9383
  • cpcalendars.tes-doau777
  • cpcalendars.tes-sc-tools-2021
  • cpcalendars.tesoyy98
  • cpcalendars.tgbdfghjkdjh
  • cpcalendars.tiv90
  • cpcalendars.tktokvral10
  • cpcalendars.tools-autoress-dira
  • cpcalendars.topup-coda-shop-gratis-15
  • cpcalendars.topup-codas-hopgratis22
  • cpcalendars.topup-freefire22
  • cpcalendars.topupgratis.subscrebchanelarif
  • cpcalendars.tutorialyoutube
  • cpcalendars.updatepayment1122
  • cpcalendars.uptrendciti07
  • cpcalendars.us-apps
  • cpcalendars.v5.event-bulanan
  • cpcalendars.verifica-portale-poste
  • cpcalendars.verificwellsfarg
  • cpcalendars.verify203
  • cpcalendars.verify380
  • cpcalendars.verifyrecoverynumber5630
  • cpcalendars.verriccattioccitiisec0b
  • cpcalendars.video-bokep-jepang-terbaru
  • cpcalendars.video-kienzyviral
  • cpcalendars.video-viral-18
  • cpcalendars.vidviral18tnte
  • cpcalendars.viral-18
  • cpcalendars.viral-grup-resmi
  • cpcalendars.viralbiduan18-v
  • cpcalendars.viralhot50
  • cpcalendars.viralnew2k21
  • cpcalendars.viralnotnotgrub
  • cpcalendars.visitright92j-profile4
  • cpcalendars.vsqtm7htbackyouholdverify
  • cpcalendars.vvip-mlayviral
  • cpcalendars.vwvpaypal
  • cpcalendars.wdag
  • cpcalendars.wdholding-cut
  • cpcalendars.web-demo-speednesia
  • cpcalendars.web-evnt02
  • cpcalendars.webmailsupportyouraccount-2345235
  • cpcalendars.wel-auth-acc-veri
  • cpcalendars.wells07
  • cpcalendars.wellsfargocomunit
  • cpcalendars.wellsfargovelifybank
  • cpcalendars.wellsffargosecureaccountdetails
  • cpcalendars.whatsapgabunggrupnotnot8
  • cpcalendars.whatsapofree18
  • cpcalendars.whatsappgroupinvitejoingroupnow
  • cpcalendars.whatsappgroupinvitejoinowgrupp
  • cpcalendars.wms-sso-biglobe
  • cpcalendars.ww3welsfargo
  • cpcalendars.www-cobraevent2021
  • cpcalendars.x1z2-tx2
  • cpcalendars.xzn
  • cpcalendars.yoru6
  • cpcalendars.ytytytguyguyyft
  • cpcontacts.00-77
  • cpcontacts.000002415612
  • cpcontacts.0000098735
  • cpcontacts.00025482341
  • cpcontacts.000321012
  • cpcontacts.000909714
  • cpcontacts.00197703388
  • cpcontacts.00197703403
  • cpcontacts.00chseacusrscuesaccauth
  • cpcontacts.0112776120
  • cpcontacts.01netfxsecurusrservr
  • cpcontacts.01rddi2fro
  • cpcontacts.021101
  • cpcontacts.021108
  • cpcontacts.0321650106
  • cpcontacts.07trempiexmgkutau
  • cpcontacts.0876132
  • cpcontacts.0876543715
  • cpcontacts.089787564509
  • cpcontacts.0909002
  • cpcontacts.0913152
  • cpcontacts.09962464
  • cpcontacts.1.new-claimgarenaff3
  • cpcontacts.1000234983928
  • cpcontacts.1000234984174
  • cpcontacts.1000234984298
  • cpcontacts.1000234985032
  • cpcontacts.1000234985251
  • cpcontacts.1000234985530
  • cpcontacts.1000234985663
  • cpcontacts.10003453463411
  • cpcontacts.100074358609
  • cpcontacts.10032041502
  • cpcontacts.100356743918
  • cpcontacts.10049610512
  • cpcontacts.100540316203
  • cpcontacts.100835477513
  • cpcontacts.1009538608
  • cpcontacts.101012078709
  • cpcontacts.1011134983686
  • cpcontacts.1011134984456
  • cpcontacts.1011134984632
  • cpcontacts.10155936206
  • cpcontacts.10175213204
  • cpcontacts.102007395903
  • cpcontacts.1023130815
  • cpcontacts.102333252919
  • cpcontacts.10263589219
  • cpcontacts.102795149108
  • cpcontacts.103252317718
  • cpcontacts.10340465218
  • cpcontacts.103416265315
  • cpcontacts.103481416702
  • cpcontacts.10349815213
  • cpcontacts.104192625714
  • cpcontacts.104272699310
  • cpcontacts.104439978818
  • cpcontacts.104789241806
  • cpcontacts.105091492503
  • cpcontacts.105237808516
  • cpcontacts.10562202804
  • cpcontacts.105648019509
  • cpcontacts.105718421201
  • cpcontacts.10608313514
  • cpcontacts.106408020905
  • cpcontacts.107308668711
  • cpcontacts.107309250602
  • cpcontacts.107315618301
  • cpcontacts.107389184518
  • cpcontacts.107463968418
  • cpcontacts.10754348917
  • cpcontacts.107573302612
  • cpcontacts.107790885612
  • cpcontacts.108342627613
  • cpcontacts.10869673714
  • cpcontacts.108790326402
  • cpcontacts.109084460715
  • cpcontacts.109177278606
  • cpcontacts.10966534708
  • cpcontacts.109693398701
  • cpcontacts.109935661309
  • cpcontacts.110209237215
  • cpcontacts.110283403901
  • cpcontacts.110481515
  • cpcontacts.111894973514
  • cpcontacts.111894973517
  • cpcontacts.111962785220
  • cpcontacts.112020928820
  • cpcontacts.112547896306
  • cpcontacts.112662367511
  • cpcontacts.112879735103
  • cpcontacts.112922363910
  • cpcontacts.113042051611
  • cpcontacts.11313013511
  • cpcontacts.11357891704
  • cpcontacts.11357891714
  • cpcontacts.113814761218
  • cpcontacts.11417401501
  • cpcontacts.11418262415
  • cpcontacts.11418262416
  • cpcontacts.114753802
  • cpcontacts.114809114802
  • cpcontacts.1149010805
  • cpcontacts.116656891317
  • cpcontacts.117968513503
  • cpcontacts.118325338208
  • cpcontacts.118886743712
  • cpcontacts.120297917706
  • cpcontacts.12031693716
  • cpcontacts.120368844304
  • cpcontacts.121392
  • cpcontacts.123158857320
  • cpcontacts.123423408
  • cpcontacts.12343446368
  • cpcontacts.124342212
  • cpcontacts.1247809378215
  • cpcontacts.12530972
  • cpcontacts.125521228
  • cpcontacts.125521233
  • cpcontacts.1286548620
  • cpcontacts.12987456340
  • cpcontacts.12support001
  • cpcontacts.13124245331
  • cpcontacts.13124245350
  • cpcontacts.1341131463
  • cpcontacts.13620269607
  • cpcontacts.138526706404
  • cpcontacts.141568688807
  • cpcontacts.143541174907
  • cpcontacts.143777949516
  • cpcontacts.151283062812
  • cpcontacts.153462559818
  • cpcontacts.153942415316
  • cpcontacts.154551218578
  • cpcontacts.154551218849
  • cpcontacts.154551218973
  • cpcontacts.154551219337
  • cpcontacts.154551219483
  • cpcontacts.154551219821
  • cpcontacts.154551219881
  • cpcontacts.154551219976
  • cpcontacts.155295376104
  • cpcontacts.1561218907
  • cpcontacts.15643530
  • cpcontacts.157433874309
  • cpcontacts.15753194915
  • cpcontacts.157836074515
  • cpcontacts.15971542902
  • cpcontacts.161470444104
  • cpcontacts.162005811402
  • cpcontacts.16963470717
  • cpcontacts.172316219520
  • cpcontacts.179187292705
  • cpcontacts.18011394713
  • cpcontacts.18281041117
  • cpcontacts.182835541717
  • cpcontacts.183496868
  • cpcontacts.1936548753
  • cpcontacts.19802365987402
  • cpcontacts.198598480215
  • cpcontacts.1li05g-0008wt-fg
  • cpcontacts.1lyldq-000egi-as
  • cpcontacts.1m3kqb-0002nj-po
  • cpcontacts.1mknms-0001zm-le
  • cpcontacts.1mnuyq-000783-sg
  • cpcontacts.1mwpvs-0003lo-24
  • cpcontacts.20022uc
  • cpcontacts.20034568748
  • cpcontacts.201054740602
  • cpcontacts.201454303
  • cpcontacts.2021-spin-free
  • cpcontacts.2029922
  • cpcontacts.20356478309
  • cpcontacts.21-11-03
  • cpcontacts.2122113202
  • cpcontacts.21321412117
  • cpcontacts.21414071311
  • cpcontacts.21762816
  • cpcontacts.2178491714
  • cpcontacts.221522137817
  • cpcontacts.2222265204
  • cpcontacts.2343535504
  • cpcontacts.23441442
  • cpcontacts.242535323
  • cpcontacts.242535342535416
  • cpcontacts.243544515
  • cpcontacts.243544524
  • cpcontacts.2456428
  • cpcontacts.24578360
  • cpcontacts.2464578800
  • cpcontacts.25012018
  • cpcontacts.25364634154
  • cpcontacts.258361652808
  • cpcontacts.2692669704
  • cpcontacts.271kuotagratis
  • cpcontacts.28200042507
  • cpcontacts.286416641411
  • cpcontacts.290kuotagratis
  • cpcontacts.2981136
  • cpcontacts.2buniwpxjvtpm5eedwni
  • cpcontacts.2jtfree
  • cpcontacts.2pemersatuxxx
  • cpcontacts.30104248218
  • cpcontacts.303030303020
  • cpcontacts.308337039317
  • cpcontacts.30844944919
  • cpcontacts.30984295112
  • cpcontacts.313131313106
  • cpcontacts.3131334574
  • cpcontacts.314242323408
  • cpcontacts.320932028
  • cpcontacts.32109910238361
  • cpcontacts.32109910238664
  • cpcontacts.3245245369
  • cpcontacts.324567013
  • cpcontacts.32542356246366751
  • cpcontacts.3256249
  • cpcontacts.33030381122
  • cpcontacts.33326789503
  • cpcontacts.334535763
  • cpcontacts.33521358966900
  • cpcontacts.3356252
  • cpcontacts.3356285
  • cpcontacts.338133676209
  • cpcontacts.344343822801
  • cpcontacts.3443513407
  • cpcontacts.344554246217
  • cpcontacts.3564745764
  • cpcontacts.3579742706
  • cpcontacts.3646452881
  • cpcontacts.367617683301
  • cpcontacts.373597426703
  • cpcontacts.376141402415
  • cpcontacts.378240872410
  • cpcontacts.378240872418
  • cpcontacts.3980020
  • cpcontacts.3980026
  • cpcontacts.3hg8ttjeyt
  • cpcontacts.3higssdomino-topbos-com
  • cpcontacts.3loginpage-wellsfargo
  • cpcontacts.3sxla14
  • cpcontacts.40001256817
  • cpcontacts.406854406107
  • cpcontacts.4073381211
  • cpcontacts.4253535317
  • cpcontacts.426576424511523
  • cpcontacts.432008513
  • cpcontacts.4322277
  • cpcontacts.432654629
  • cpcontacts.43290080
  • cpcontacts.43577899735
  • cpcontacts.438002019701
  • cpcontacts.4412331285
  • cpcontacts.44434405
  • cpcontacts.44444254621216295
  • cpcontacts.44448566566295
  • cpcontacts.445654431
  • cpcontacts.44757535502
  • cpcontacts.45195522010
  • cpcontacts.45423402108
  • cpcontacts.45423402393
  • cpcontacts.45423402564
  • cpcontacts.45615152
  • cpcontacts.456465460
  • cpcontacts.456555606
  • cpcontacts.4568917604
  • cpcontacts.456987663416
  • cpcontacts.46464657717
  • cpcontacts.4665418887519
  • cpcontacts.4758687681
  • cpcontacts.48426731701
  • cpcontacts.48478413205
  • cpcontacts.49005886
  • cpcontacts.4dammik4
  • cpcontacts.50017688612
  • cpcontacts.5003982844
  • cpcontacts.50505077
  • cpcontacts.519836873406
  • cpcontacts.5301479863516
  • cpcontacts.5312124
  • cpcontacts.53434222143
  • cpcontacts.5345429
  • cpcontacts.545342328
  • cpcontacts.545454563
  • cpcontacts.5468917519
  • cpcontacts.55182664419
  • cpcontacts.55553689546291
  • cpcontacts.55555553333202
  • cpcontacts.556434502
  • cpcontacts.56341245
  • cpcontacts.56987416402
  • cpcontacts.573000716111
  • cpcontacts.5yb3g2420wgenr
  • cpcontacts.6000115525688605
  • cpcontacts.622147001102
  • cpcontacts.62214701408
  • cpcontacts.632148789502
  • cpcontacts.636356313
  • cpcontacts.637895412114
  • cpcontacts.642317619904
  • cpcontacts.6525432431
  • cpcontacts.6545402
  • cpcontacts.6576567521
  • cpcontacts.670523223816
  • cpcontacts.6758473736616
  • cpcontacts.676588224
  • cpcontacts.676756544104
  • cpcontacts.677044369120
  • cpcontacts.69781740000031
  • cpcontacts.7008321
  • cpcontacts.70124578904
  • cpcontacts.74563214704
  • cpcontacts.745698114517
  • cpcontacts.75647410815
  • cpcontacts.7634121181
  • cpcontacts.768275319802
  • cpcontacts.77465358
  • cpcontacts.7776655433412
  • cpcontacts.777777718
  • cpcontacts.7846232
  • cpcontacts.785252654512706
  • cpcontacts.7864328
  • cpcontacts.7893652445
  • cpcontacts.789876544356705
  • cpcontacts.796855377307
  • cpcontacts.79712115
  • cpcontacts.800011333456688614
  • cpcontacts.80005614
  • cpcontacts.801111426100688618
  • cpcontacts.801111444441688600
  • cpcontacts.802215483300688615
  • cpcontacts.80741028614
  • cpcontacts.80938455912
  • cpcontacts.8110000238386
  • cpcontacts.8110000238411
  • cpcontacts.8414111149
  • cpcontacts.8475795255
  • cpcontacts.8520147099811
  • cpcontacts.855746104506
  • cpcontacts.85784525508
  • cpcontacts.87434577786726
  • cpcontacts.87483463453
  • cpcontacts.87483463458
  • cpcontacts.875852320
  • cpcontacts.8764287667
  • cpcontacts.877877914
  • cpcontacts.8778996643154816
  • cpcontacts.879444567911
  • cpcontacts.8813881019
  • cpcontacts.883109
  • cpcontacts.88552213
  • cpcontacts.8881106
  • cpcontacts.88852325952504
  • cpcontacts.888655416
  • cpcontacts.888985236517
  • cpcontacts.90854964
  • cpcontacts.9422222201
  • cpcontacts.96320564457905
  • cpcontacts.96586321406
  • cpcontacts.9663404785905
  • cpcontacts.99881333125
  • cpcontacts.9991351217
  • cpcontacts.9996852689616
  • cpcontacts.9trpdxvg6k60ixnmzoe5
  • cpcontacts.a9471fa9084747e15b1e56b2e85a8539
  • cpcontacts.account-idx-id21311
  • cpcontacts.accout-revsconnect10
  • cpcontacts.aderp-chase-lcokif
  • cpcontacts.adm-wefglog-dashb0ard
  • cpcontacts.adobereader5
  • cpcontacts.adresources
  • cpcontacts.advan-server31
  • cpcontacts.advanceservernow
  • cpcontacts.ajdijaiwdjiajdiawjdia
  • cpcontacts.akunfreefire6554
  • cpcontacts.alertsuncoast
  • cpcontacts.alwayssecureonline
  • cpcontacts.amazon-signin-87o11-102
  • cpcontacts.amazonaccount-servicecentre032
  • cpcontacts.amazonconfirmaccountactiviti
  • cpcontacts.ambil-hadiah-abang18283
  • cpcontacts.ambil-hadiah-mu-disini-new84
  • cpcontacts.ambil-hadiahmu-disini
  • cpcontacts.ambil-new
  • cpcontacts.ambil-ni.budikencong
  • cpcontacts.ambilhadiahfreefiee
  • cpcontacts.amz-updatedetails465
  • cpcontacts.amz-updatedetails514
  • cpcontacts.amzon-signin-8174kjhztw3573
  • cpcontacts.amzon-signin-8715kezrz334
  • cpcontacts.amzsignin-hgmdownuofmaceiul320
  • cpcontacts.amzsignin-nxmatbsu601t1i0i5ev113
  • cpcontacts.amzsignin-ziaynaaekseprhkynmn211
  • cpcontacts.asiavideotaiwans34
  • cpcontacts.auq21
  • cpcontacts.auth04-citizensonline
  • cpcontacts.auth05b
  • cpcontacts.auth3-satander
  • cpcontacts.authentication-needed-citi
  • cpcontacts.authmtbusers
  • cpcontacts.authverifiedservicecitii
  • cpcontacts.authverifycitizens
  • cpcontacts.auto-ress-dayat-gg
  • cpcontacts.autoressakhyul
  • cpcontacts.azce4
  • cpcontacts.b3076790148240f265797b21ac6d24eb
  • cpcontacts.balloonhouse
  • cpcontacts.bancet-letik
  • cpcontacts.bandzforme04
  • cpcontacts.bape-bape
  • cpcontacts.becuu-0mlline
  • cpcontacts.boadesksupport
  • cpcontacts.bocilpinktiktok1
  • cpcontacts.bokeffull-indocrot5
  • cpcontacts.bokep-news685d
  • cpcontacts.bokep-viral-indo-klikini2021
  • cpcontacts.bokep-viral777
  • cpcontacts.bokepautocrotcrot18dewasa
  • cpcontacts.bokepviral8
  • cpcontacts.bokepviralbocil-smp2022
  • cpcontacts.bolakoplastik
  • cpcontacts.born2-b3-wild87
  • cpcontacts.bro-sh3
  • cpcontacts.broinwar
  • cpcontacts.bundleclaim-event-freefire21
  • cpcontacts.buruan-ambil-hadiah-ff098
  • cpcontacts.c0nf1m-3sc
  • cpcontacts.c1pubg20
  • cpcontacts.c1t2i
  • cpcontacts.cal01b
  • cpcontacts.callieddbooa
  • cpcontacts.caragantijasakirimshopee
  • cpcontacts.cashapp-repaircode198876
  • cpcontacts.cashappmemorytheverify
  • cpcontacts.chaseaccountverify
  • cpcontacts.chat-whatsaapjoin99gq
  • cpcontacts.chat-whatsapp-com-cxw3frhieneixu
  • cpcontacts.chatvideocallnakal24
  • cpcontacts.chatwhastappbudi01gaming
  • cpcontacts.chatwhatsappsex13
  • cpcontacts.chipfree-dominohiggs
  • cpcontacts.chse01usrscurserver
  • cpcontacts.ci2eee3everi5vie
  • cpcontacts.ciittzin
  • cpcontacts.cit1verifyuser
  • cpcontacts.citisafeuseracessgrant
  • cpcontacts.citizanshelp
  • cpcontacts.citizen-bank-verify09
  • cpcontacts.citizvert
  • cpcontacts.citsecure04-prior
  • cpcontacts.claim-bundlenew-gratis
  • cpcontacts.claim-diamondgratis-skrg
  • cpcontacts.claim-disini1
  • cpcontacts.claim-even-garena31
  • cpcontacts.claim-evenff04
  • cpcontacts.claim-event-customroom2021
  • cpcontacts.claim-event-ml-diamon-gratis985
  • cpcontacts.claim-event44
  • cpcontacts.claim-eventgarena-com
  • cpcontacts.claim-events579
  • cpcontacts.claim-evnt426
  • cpcontacts.claim-free196
  • cpcontacts.claim-hadiah-gratis-ff-new2
  • cpcontacts.claim-hadiah-terbaru-78
  • cpcontacts.claim-item-free-new255
  • cpcontacts.claim-item-gratismu
  • cpcontacts.claim-item-terbaru-garena828737
  • cpcontacts.claim-itemfreefire768
  • cpcontacts.claim-ml-moonton
  • cpcontacts.claim104codashop
  • cpcontacts.claimbundle2006
  • cpcontacts.claimevent-gratisff78
  • cpcontacts.claimeventff-xyz7
  • cpcontacts.claimeventgratis7
  • cpcontacts.claimffevents1
  • cpcontacts.claimgift-pubgevent
  • cpcontacts.claimhadiahtersembunyi-2021
  • cpcontacts.claimincubatornewff1
  • cpcontacts.claimitem900xy
  • cpcontacts.claimitemff29
  • cpcontacts.claimitemff489
  • cpcontacts.claimitemnew17
  • cpcontacts.claimneww2
  • cpcontacts.claimsekarang182
  • cpcontacts.clamitem-freefire-ggz1
  • cpcontacts.cloud.subsitemff
  • cpcontacts.coda-game79
  • cpcontacts.codaashop-bug2021
  • cpcontacts.codahsgshopfreefieeff
  • cpcontacts.codashop-2k21fws
  • cpcontacts.codashop-bagibagidiamonds2022
  • cpcontacts.codashop-bydanzstoter-topupallgame88
  • cpcontacts.codashop-diamonds-gratis49
  • cpcontacts.codashop-evnt12
  • cpcontacts.codashop-ff-kulgar
  • cpcontacts.codashop-free-even
  • cpcontacts.codashop-gratis-youtuber2022
  • cpcontacts.codashop-gratisan156
  • cpcontacts.codashop-kulgarinfo69
  • cpcontacts.codashop2190
  • cpcontacts.codashop6625
  • cpcontacts.codashop826
  • cpcontacts.codashopdm-gratis2021
  • cpcontacts.codashopff09
  • cpcontacts.codashopfreefire923
  • cpcontacts.codashopfreefireind1
  • cpcontacts.codashopfreenow5
  • cpcontacts.codashops1
  • cpcontacts.codashopterbaruresmi2021
  • cpcontacts.codashopxfreefire
  • cpcontacts.codashpp-eventgratis
  • cpcontacts.coderedeemfreefire
  • cpcontacts.coinbswgkjclz
  • cpcontacts.com-bokepterbaru
  • cpcontacts.conffirmautho
  • cpcontacts.connect-verfy
  • cpcontacts.connect368-verified
  • cpcontacts.consum
  • cpcontacts.courtyzyu32
  • cpcontacts.cshesupdte
  • cpcontacts.dboggphhj1tz7hzihrcf
  • cpcontacts.deskuser-clientservice037
  • cpcontacts.dfreaw78
  • cpcontacts.dghg-ffggg00
  • cpcontacts.diamond-clm20
  • cpcontacts.dis-managmentservice
  • cpcontacts.dm-gratiss
  • cpcontacts.domain-zaxx-garena91
  • cpcontacts.dotoalljop
  • cpcontacts.durasifullgrupwa5
  • cpcontacts.e031f7ada4a91cf22d64505289cae2a5
  • cpcontacts.e42ry5-t76k6pq-d3m
  • cpcontacts.easyaccess
  • cpcontacts.ec3dc624abd8
  • cpcontacts.even-freefire-gratisgg72
  • cpcontacts.even-freefireffac
  • cpcontacts.evenff-agustus0
  • cpcontacts.evenff2022free
  • cpcontacts.event-bandle-old-gratis
  • cpcontacts.event-claim-garena-aman8473
  • cpcontacts.event-claim-gg63947
  • cpcontacts.event-coda-free-new2022
  • cpcontacts.event-codashop0
  • cpcontacts.event-crate-freefire289
  • cpcontacts.event-efootball-pes2022
  • cpcontacts.event-ff-codashop39
  • cpcontacts.event-ff-free17
  • cpcontacts.event-ff-terbaru-claimhadiah-resmidariku
  • cpcontacts.event-ffimclaim
  • cpcontacts.event-ffmax-gratis21
  • cpcontacts.event-freefire-220
  • cpcontacts.event-freefire2-com
  • cpcontacts.event-freefiregratis00
  • cpcontacts.event-freefirespin221
  • cpcontacts.event-gratis-free-fire-20190
  • cpcontacts.event-gratis-terbaru715
  • cpcontacts.event-mclerent2021
  • cpcontacts.event-newgarena85-agustus
  • cpcontacts.event-old-gratis54
  • cpcontacts.event-resmi-ff-010478
  • cpcontacts.event-setelah-maintance-ff
  • cpcontacts.eventbagihadiah
  • cpcontacts.eventcodashop2022allgame
  • cpcontacts.eventfreefire-gz000
  • cpcontacts.eventfreefirebug2021
  • cpcontacts.eventfreefiregratisitembaru2021
  • cpcontacts.eventgarenanew-freefire2021
  • cpcontacts.eventgratis-evogun2021
  • cpcontacts.eventgratis-ffv4
  • cpcontacts.eventgratis-garenaff7
  • cpcontacts.eventluckyspin-freefire2021
  • cpcontacts.eventml2022
  • cpcontacts.eventmlbb.event-gg-88
  • cpcontacts.eventmllbqnew
  • cpcontacts.eventspesial-mobilelegendsbangbang
  • cpcontacts.eventtersembunyi-01
  • cpcontacts.eventxclaimnew122
  • cpcontacts.evnt-resmi-garena99
  • cpcontacts.evnt.claimbundelfreefire
  • cpcontacts.evrfaccnkntlgadang
  • cpcontacts.extensionciti-view
  • cpcontacts.fblike
  • cpcontacts.fewgr3ehg424
  • cpcontacts.ff-claim-trueid
  • cpcontacts.ff-even-universary4
  • cpcontacts.ff-event-gratis0387
  • cpcontacts.ff-garena-2022
  • cpcontacts.ff-geratisx2021
  • cpcontacts.ff-spins-terbaru0012
  • cpcontacts.ffclaimitem.claim-event-fire-free
  • cpcontacts.ffdaymen
  • cpcontacts.ffgarenafreefireyt
  • cpcontacts.ffitemgg.event-ff-24
  • cpcontacts.ffmaxspin-xzya
  • cpcontacts.ffwordseries
  • cpcontacts.followthestepsbelow
  • cpcontacts.fotograferganteng
  • cpcontacts.fre-firee
  • cpcontacts.free-dmfreefire
  • cpcontacts.free-fire-codashop-free
  • cpcontacts.free-fire-event-22
  • cpcontacts.free-fire-event-crate
  • cpcontacts.free-fire-gratis4
  • cpcontacts.free-fire-spin-2021-2022
  • cpcontacts.freeclaimsgarena-news4
  • cpcontacts.freediamondcoda2022
  • cpcontacts.freeefireeventold2021
  • cpcontacts.freefire-claim-event-real
  • cpcontacts.freefire-claim-events
  • cpcontacts.freefire-garena-ffmax
  • cpcontacts.freefire-garenabgidnew
  • cpcontacts.freefire-redtheme
  • cpcontacts.freefireclaim36232
  • cpcontacts.freefireitemnewvvip
  • cpcontacts.freemembernew350
  • cpcontacts.freespin01
  • cpcontacts.gabung-grup-crot528
  • cpcontacts.gabung-grupwhasapp18xx
  • cpcontacts.gabung.grub-tante18
  • cpcontacts.gabung2whatsapp
  • cpcontacts.gabunggrup-bokepterbaru2022
  • cpcontacts.garena-batleground
  • cpcontacts.garena-event55
  • cpcontacts.garena-freefiree88
  • cpcontacts.garena-giveaway2020
  • cpcontacts.garenaevnt-ntub
  • cpcontacts.garenaffevent-freeclaims2
  • cpcontacts.garenatrueid2014
  • cpcontacts.gateway-zsezt
  • cpcontacts.gcxgfdhn
  • cpcontacts.gg-parah
  • cpcontacts.go-evnet11
  • cpcontacts.goysiwgjo
  • cpcontacts.gratis-spinbundel-freefire
  • cpcontacts.gratisff-freeklik4
  • cpcontacts.grdsdsq
  • cpcontacts.grebwattg
  • cpcontacts.greenstatesecureeverify
  • cpcontacts.gropwadewasa18
  • cpcontacts.grouptantecantik21
  • cpcontacts.grubbokepviralterbaru189
  • cpcontacts.grubparayt.paragrub18
  • cpcontacts.grubviralterbaru06v
  • cpcontacts.grubwa-82
  • cpcontacts.grubwavrltrbru1
  • cpcontacts.gruop-18-join
  • cpcontacts.grup-bkp157
  • cpcontacts.grup-bkp18-2022
  • cpcontacts.grup-notnotcantik2022
  • cpcontacts.grup-okep-ah-wik22
  • cpcontacts.grup-vcs-tante
  • cpcontacts.grup-viral-18-terbaru1
  • cpcontacts.grup-whatsapp69plus
  • cpcontacts.grupbokepterbarux2022
  • cpcontacts.grupchat-bokep18
  • cpcontacts.grupdewasa-viralindonesia
  • cpcontacts.grupokepviiiralll-2022
  • cpcontacts.grupsmaviralterbaru
  • cpcontacts.grupwasange42
  • cpcontacts.gtwa-vvip2
  • cpcontacts.hadiah-asli-bukan-hadiah-tipu-www-com
  • cpcontacts.hadiah-bosku
  • cpcontacts.hadiah-darigarena-78
  • cpcontacts.hadiah-freefire-gratis87
  • cpcontacts.hadiah-freefire9
  • cpcontacts.hadiah-pubg-free
  • cpcontacts.hadiah-skin-ff-gratis
  • cpcontacts.hadiah-terbaru44
  • cpcontacts.hadiahgratisbundle27
  • cpcontacts.hadiahitemff
  • cpcontacts.hanyasaja
  • cpcontacts.hari-merdeka-17-agustus
  • cpcontacts.hellodere
  • cpcontacts.help-anidemasingan
  • cpcontacts.help-user1985918264
  • cpcontacts.helpsecuremyaccount700b
  • cpcontacts.hermann.subdomainssess
  • cpcontacts.higgsdomin01.topbos1
  • cpcontacts.hrs11
  • cpcontacts.humanadoberesources
  • cpcontacts.i.ambilhadiahff-vvip
  • cpcontacts.idsjlytfvbeaotzdilpl
  • cpcontacts.ifengarena
  • cpcontacts.increagionsinfohelpreset
  • cpcontacts.infofreecoda1
  • cpcontacts.infogarenaclaim
  • cpcontacts.informationresource-efs-0d7center
  • cpcontacts.infoverifysecure9nauthe
  • cpcontacts.ip-00athalliance
  • cpcontacts.item-dm-gratisff737
  • cpcontacts.itemffgratis2022-xyz
  • cpcontacts.ivent-diamond-gratis
  • cpcontacts.jaksnnvcjxks2
  • cpcontacts.jembut30
  • cpcontacts.jger2
  • cpcontacts.join-grup-bokep-indoo
  • cpcontacts.join-grup-wa-111
  • cpcontacts.join-grupfrontalgg
  • cpcontacts.join-grupo
  • cpcontacts.joingrup-okep-8901
  • cpcontacts.joingrupchika2el
  • cpcontacts.jojodanan
  • cpcontacts.kacang-korok05
  • cpcontacts.kalim-new00
  • cpcontacts.kaycee14
  • cpcontacts.kekuatan-ewesoang
  • cpcontacts.kepin-shabushabu
  • cpcontacts.klaim-di-sini-cok
  • cpcontacts.klaim-ff-grais
  • cpcontacts.klaim-gratis319
  • cpcontacts.klaimdisiniaichanewu
  • cpcontacts.klaimff39eudjh
  • cpcontacts.klaimff928r
  • cpcontacts.kumpulan-viral-2022
  • cpcontacts.loriorkate
  • cpcontacts.lucky-freefire-67
  • cpcontacts.lucky-freefire-90
  • cpcontacts.lucky-spinfreefire54
  • cpcontacts.luckyspin-6252
  • cpcontacts.luckyspin-terbaru-freefire
  • cpcontacts.luckyspinterbaru-fast-team77
  • cpcontacts.luthfijb-menu-jasdit
  • cpcontacts.m92380-secureme
  • cpcontacts.macver
  • cpcontacts.maharajamobileshop
  • cpcontacts.mailsupport6
  • cpcontacts.main1-pageservice10
  • cpcontacts.mainpageuser6
  • cpcontacts.maintestgo
  • cpcontacts.mainusrpage9
  • cpcontacts.marsel-gz-nibos
  • cpcontacts.masdiua3ura78sjhjk
  • cpcontacts.masmari9
  • cpcontacts.masukgrup-whatsappviral
  • cpcontacts.mediafirechikavirall20jt
  • cpcontacts.mediafirexxxbaru
  • cpcontacts.mentatulunga
  • cpcontacts.meretulung
  • cpcontacts.michealmanuel2
  • cpcontacts.midasbuyy87cx
  • cpcontacts.ml-claim55
  • cpcontacts.mlbbluckyspin
  • cpcontacts.mlbbxstarwars
  • cpcontacts.mldd9
  • cpcontacts.mobile-legends-official-free-skin
  • cpcontacts.mohdraji955
  • cpcontacts.moontonevent999
  • cpcontacts.msecuret1b
  • cpcontacts.mtb-4safeinfo
  • cpcontacts.mtbnk-1
  • cpcontacts.mtbveridresechl
  • cpcontacts.mtsecaler365
  • cpcontacts.mttverify0b
  • cpcontacts.mvso0ppji
  • cpcontacts.mxchse99x
  • cpcontacts.n3tflixsecure3
  • cpcontacts.n4iyudr03rrgjeosxj5v
  • cpcontacts.nd23z6kana
  • cpcontacts.net6bverify
  • cpcontacts.netfflix
  • cpcontacts.netfflxdatpaymt
  • cpcontacts.netflixxtab
  • cpcontacts.netflxauth03paym3nt
  • cpcontacts.netflxpaymntupdat
  • cpcontacts.netverufsecutr4
  • cpcontacts.new-frefire2021-2022
  • cpcontacts.new-grubkp18
  • cpcontacts.newm6uzev4
  • cpcontacts.newsmaintance-eventfreefire
  • cpcontacts.ninyi
  • cpcontacts.not3ntr3al
  • cpcontacts.notnot-giveawayspecial0283773
  • cpcontacts.nurustunjungteing
  • cpcontacts.nvusra
  • cpcontacts.ob-secure-check07
  • cpcontacts.oedpaye
  • cpcontacts.office3365
  • cpcontacts.office365-secureverification
  • cpcontacts.okgesya2
  • cpcontacts.olkujimano
  • cpcontacts.on6medicaloutlet8a37-092c099c85cf
  • cpcontacts.onetimeldentificationpage
  • cpcontacts.onlineauth-sec1qveri01
  • cpcontacts.onlineloginssokhhu
  • cpcontacts.onpoint-cualert
  • cpcontacts.order2037738
  • cpcontacts.page-mtmsg
  • cpcontacts.pagecoinbase-supportupdate
  • cpcontacts.paijomumetndaseditinggalbojone3131123321
  • cpcontacts.palpay-supportteam
  • cpcontacts.panelgg2
  • cpcontacts.pdhefw
  • cpcontacts.pemberitahuan-pembelokiran-facebook-21
  • cpcontacts.pertimpahansains0021
  • cpcontacts.pinkbagetkayakkamu
  • cpcontacts.pkls2
  • cpcontacts.pmbaikan
  • cpcontacts.pornoindo50
  • cpcontacts.pprep0rtpr0bl3ms
  • cpcontacts.prime-renewalmembrshipamzcspl
  • cpcontacts.prime-updatepaymentservice
  • cpcontacts.protectnavyfederal
  • cpcontacts.pubggamemobilnewevent
  • cpcontacts.pubgmkarakin
  • cpcontacts.pubgmmm
  • cpcontacts.pubgmxsuits0283
  • cpcontacts.rafiqganteng
  • cpcontacts.receipt-appleid
  • cpcontacts.reconnect-web53
  • cpcontacts.redirct-admciti03
  • cpcontacts.redrittoebsec4
  • cpcontacts.resmi.event-tersembunyi0169
  • cpcontacts.rilando-pages
  • cpcontacts.s1mintok
  • cpcontacts.s5c-w5b-cli5nt
  • cpcontacts.santossslink
  • cpcontacts.sc3.testsccurl1
  • cpcontacts.scvpt
  • cpcontacts.sdf423wds3
  • cpcontacts.sec-verify-878
  • cpcontacts.sec0re01-mt-vfy10
  • cpcontacts.sec3ureverifiy
  • cpcontacts.secumyportal
  • cpcontacts.secure-account-information
  • cpcontacts.secure-logon07c
  • cpcontacts.secure-m8
  • cpcontacts.secure-mybank0famerica
  • cpcontacts.secure-recovery
  • cpcontacts.secure-welsfargoconnect
  • cpcontacts.secure09a-webauth-secure-auth
  • cpcontacts.secure1-wellsfargo
  • cpcontacts.secure111
  • cpcontacts.secure1a-auth
  • cpcontacts.secure1rsverify
  • cpcontacts.secure38xverify
  • cpcontacts.secure4u8ctizzx
  • cpcontacts.secure653verify
  • cpcontacts.secure9z-citizen
  • cpcontacts.securearthverifyinfob3us
  • cpcontacts.securec950verify
  • cpcontacts.secured-03-verify
  • cpcontacts.secureiojiverify
  • cpcontacts.securemectzvry
  • cpcontacts.securenhsiverify
  • cpcontacts.secureservice-31bwellsfargo-0nlineprotec
  • cpcontacts.secureveryfyinfoauthb3er
  • cpcontacts.securewells7878
  • cpcontacts.securonline
  • cpcontacts.securuf
  • cpcontacts.senyuman-manis
  • cpcontacts.serure-09
  • cpcontacts.serv-chserst06
  • cpcontacts.servcurebaezonmaolenobosert
  • cpcontacts.service0internal-update
  • cpcontacts.servicecsamz257
  • cpcontacts.servicecspp54721
  • cpcontacts.servicecssam87498321
  • cpcontacts.servicehost08
  • cpcontacts.servmailapps2
  • cpcontacts.shopnophateam
  • cpcontacts.shortn
  • cpcontacts.signin-updatepaymentmembershipamazon
  • cpcontacts.simontok-xxxporn2022
  • cpcontacts.sing-tel-sg
  • cpcontacts.sitirinda-rodiah20213
  • cpcontacts.sixxsixh
  • cpcontacts.slebewhsyufhasdoisjaislebew
  • cpcontacts.spin-incubator-ff11
  • cpcontacts.spin-item-menarik-free-fire4
  • cpcontacts.spin-kehokian-kalian-2021-com
  • cpcontacts.spinbundelolddanterbaru
  • cpcontacts.spinfreefirev1
  • cpcontacts.ssh2012675
  • cpcontacts.startuplifecast
  • cpcontacts.store-web-kebutuhan-hosting12
  • cpcontacts.suara-manusia
  • cpcontacts.successfulstore
  • cpcontacts.suncoasttcrdituni0n
  • cpcontacts.support-fraudsigon
  • cpcontacts.supportsecuredhost
  • cpcontacts.syalalalanxcihvhuiewwlalala
  • cpcontacts.systematicbillingsuspendedlockedmailacct
  • cpcontacts.taxinformation-irs
  • cpcontacts.terbarufree-garena4
  • cpcontacts.terkentoodd
  • cpcontacts.tes9-zip
  • cpcontacts.thread-lovedme
  • cpcontacts.tiktok-okep0707
  • cpcontacts.tje0a6ymkqrr
  • cpcontacts.tombo-s4op
  • cpcontacts.topupcodashopfreefire
  • cpcontacts.trackingupdate
  • cpcontacts.transfer000
  • cpcontacts.tsferita
  • cpcontacts.txk
  • cpcontacts.uhxgq2sb6xdc
  • cpcontacts.umleiten-amazon
  • cpcontacts.usermainpage1
  • cpcontacts.uwisoww
  • cpcontacts.venom-pro-gg
  • cpcontacts.verchas
  • cpcontacts.verf02citi0zens
  • cpcontacts.veri-auth
  • cpcontacts.verificati0n-chas307b
  • cpcontacts.verificatnonline
  • cpcontacts.verify416
  • cpcontacts.verify88
  • cpcontacts.verify93
  • cpcontacts.vidio-viral-222
  • cpcontacts.vidio-viral-mantap
  • cpcontacts.viral-terbaru-bikin-penasaran-2022
  • cpcontacts.wagrubnewgctp890
  • cpcontacts.wahyuwhm1
  • cpcontacts.wallunique
  • cpcontacts.wangy-wangy
  • cpcontacts.we-mut-auth-ne
  • cpcontacts.web-gettverif004
  • cpcontacts.web-nohoax2021-terbaru-ambil
  • cpcontacts.webserver-amazon
  • cpcontacts.weiisfargo-statement
  • cpcontacts.weisfagor3dcnnt
  • cpcontacts.wellsfargseq
  • cpcontacts.wetake12
  • cpcontacts.wfme
  • cpcontacts.whatsaapbokep
  • cpcontacts.whatsapp-chat2021new
  • cpcontacts.whatsapp786
  • cpcontacts.wise016
  • cpcontacts.wt-q53r-dref
  • cpcontacts.wwautff-grta
  • cpcontacts.wwwautoverifyaccountlogin
  • cpcontacts.wwwgrupwa833
  • cpcontacts.xfinity-sign-in-secure3d
  • cpcontacts.xsrvv
  • cpcontacts.yevwjqgsuzktj9nxwjtz
  • cpghtfqlyy
  • cpi2hdd
  • cpudgvclgb
  • cpv0u5xl5
  • cqmdqpvbly
  • crap123
  • craznews49pers
  • create-smash-cutback
  • crestonml
  • cristhiam
  • crmuuk
  • cropzonevpn
  • crossweb
  • crvnnupczd
  • cryptofollow
  • crzwvbgo
  • csbisrv2
  • csgoyun
  • cshi55
  • cskim-vpn2.duckdns.orgcskim-vpn2
  • ctmut8c
  • ctrmoyigjl
  • cu5qdem5dyymxzk
  • cudeytauy
  • cukcjfbxxo
  • culpbaget
  • curl-raka
  • currentappstore8826738383updateapple
  • cusedi
  • cusgaili
  • customer-oriented
  • cuvvfemgzd
  • cvcxyypjui
  • cvdf95
  • cvglbtwbzv
  • cvpu
  • cvtggokixt
  • cwhbijjmjq
  • cwqumbarij
  • cxbgiabxwe
  • cxbogmlrhz
  • cxdbhfpvya
  • cxdfclpkl
  • cxxadsiila
  • cxxemcpmre
  • cyber-helen-box
  • cyberhosp
  • cynergy
  • cyqssg5th
  • cysroost
  • cyviqfvsxd
  • cyxliqafzk
  • czaserty
  • czkawobpko
  • d.zion5
  • d04e0614f19aa6a1f1e408ae2b9dbadd
  • d17hs
  • d1e7oj7
  • d4amt2
  • d4utfh2skj.event-itemold-gratis-2021
  • d4vpn07
  • d8j4l61iq
  • daehosystem
  • daffylucy
  • dakhmjbnkj
  • daksbpalzr
  • damtrafikbt
  • daniiipi
  • darchi
  • darkasdf2
  • darkflower
  • darkii89
  • darklilord
  • darko11
  • darkrider
  • darkstat.mauixer.south-fork
  • dartserafim
  • das-schlaf
  • dasgev
  • dashboard.lingle
  • dashboard.netmaker.voroskoi
  • data.kfaasd
  • datace
  • dathan
  • datingcmv
  • datingflw
  • datingo8604
  • daubsonarr
  • davefer
  • davesworld
  • davidemomonari
  • davidnuc
  • davsmart
  • dawpi
  • dawseyhass
  • daytrafle
  • dayusu
  • dayzevolucao
  • dbdikbtwfs
  • dbsquad-grafana
  • dbwsedilym
  • dcarlbom
  • dcinemaxze
  • dcinemb2jk
  • dcnmxcvixc
  • dcsha
  • dct5228
  • dctcsely
  • dctv-nextcloud
  • ddesfod
  • ddesfua
  • ddeshp8
  • ddesifu
  • ddesixk
  • ddeslfr
  • ddesllr
  • ddesp2z
  • ddespae
  • ddesshk
  • ddqcpooazg
  • debianbox
  • debuchkp94m
  • debuchkpeya
  • deckerone
  • declined-on-patreon.mayper54ne
  • deconz.soulassassin
  • dedatfpktc
  • deepines
  • defensa
  • defund
  • degabportainer
  • dehennesyhomeassistant
  • deicommoo
  • deitires
  • deller
  • delsrhutem
  • deluge.phylundite
  • demogis
  • denemeki
  • deniseandjeff
  • dennisnas
  • dennzyboy
  • dentalmed
  • depdfmanualy1t
  • depticoun
  • der5shaun
  • descargar-action-windows-8
  • descargar-adobe-premiere-pro-cs6-full
  • descargar-intagram
  • descargar-itv
  • descargar-mudica
  • designlli
  • desingertopbrandsforsale
  • desirelosaksmobi
  • deutchbuci1sf
  • deved
  • devhageoff
  • deviceacctb-recoverysb
  • devilfp
  • devised-beneath
  • devlobsters-documentserver
  • dexman
  • df14501e4b8b31f16166e47d7a903685
  • dfathudin
  • dffizegjxj
  • dfg9h48f
  • dfilew64
  • dfilew6n
  • dfru7m
  • dfsmbfdouu
  • dfvhuhdkdm
  • dfzkaezmcb
  • dghjkl
  • dgmdyvdcxc
  • dgrhhbdxfe
  • dgsjimwdnz
  • dhalglcehd
  • dhatuksa-mhatridnm-32894023
  • dheohnew
  • dhgftftmsf
  • dhhsst
  • dhq55fkb
  • dhu2howmj
  • diamond-gratis-dari-moonton
  • diamondclaimff2021
  • diamondcodashop-gratis
  • diamondffgratiss-1
  • diamondglaz-speed
  • diamondgratis-resmicoda1
  • diantarabunga2
  • diaoje.domsusu
  • diasapas
  • dibp9y
  • dichasial
  • digyweb
  • dijifsof
  • dijkeartt
  • diliegros
  • dimeda
  • direjor
  • dirkrqjeyj
  • discojockey
  • disconnecter
  • discount51
  • disneman
  • dissolve
  • disthilpo
  • ditdjnakkj
  • divinepricer
  • divxfilmeow2
  • divxfilmep6q
  • dixonnc
  • dizovaug
  • djklausvpn
  • djpanda
  • dkozkphrqx
  • dlibdkp
  • dlibf1r
  • dlibjr7
  • dltvcsbubf
  • dmb27
  • dmbasa
  • dmkdwcnwpz
  • dmnstsgusr
  • dnabdim
  • dnbcrfgrcg
  • dnbqvgyrku
  • dnnrmzwfcu
  • dnsudp
  • dnyjdji6
  • dobpqrsstz
  • dochudson
  • docommoe
  • docomorjfa
  • docomosojl
  • docomotabd
  • docomowgkm
  • dodoomv
  • dom-assistant
  • domain-freefire-asli
  • domiani
  • domotica-damico.duckdns.orgtttttdomotica-damico
  • doorsdonwest
  • doph
  • dorcope
  • doreason-followingonredirectedsecurited
  • dorktastic
  • dotronix-ozden-a
  • dotucmi
  • dotvbtxonh
  • downvidsfbfb63
  • dqluizcjpb
  • dqnujpnbet
  • dqwwgrwwpw
  • draft
  • dragao
  • dragon-ball-raging-blast-2-pc-licence-key-free.com-iamre.mose19id
  • drakoss
  • drawffgratis
  • drazler
  • drbamo
  • dream2
  • drive.fileserver09
  • drive.letterofhope
  • drivealfaiot
  • driveflix
  • drivevpn
  • drjsfpdqmfx.musicbar
  • drknes
  • drmzbgejhe
  • drpdavid
  • drupalstaging
  • drxfmtyivl
  • drxhysedyhe
  • dsagrehxzv
  • dsaha
  • dsaxwrty
  • dsbfjnfmtg
  • dsfsdgds
  • dsoftvpn3
  • dspeybeke
  • dssd
  • dtams15
  • dtnbezbimw
  • duck-one
  • duck32ruahep8r
  • duck45oeolillf
  • duckaz9oipivak
  • duckddhomesalbedirect.3ntity
  • duckf2fwu8awew
  • duckin9oexq9on
  • duckp9ifnta4wp
  • duckqnj3ilhgyf
  • duckrlu0dmhpok
  • duckx7nt6ff60d
  • duckznkz7mr14r
  • dulsqxwsaj
  • dumasloc
  • dundundun
  • duniagame-7
  • duofbwmfyf
  • duskinus
  • duuoclhskp
  • duvetcovers
  • duyun
  • dvcasa
  • dvijiquoyl
  • dvrgrtgesc
  • dvsiguli
  • dvwfbwexdl
  • dwelpostma
  • dwqnog
  • dws-dr-3765
  • dwzwwdtypr
  • dxkxaopzja
  • dxo4z9psxn9kkl3l1xrttc7ergruech81a8l6ey3u2yqojt1bh8pwlkavscvuuk.servlcemail-conflrmxfinity991
  • dxribas
  • dxtjdydsit
  • dxtvdbgwyy
  • dy-lab
  • dyoh
  • dyvpn
  • dyzoaj
  • dz-blnk-one
  • dzaolpfhgj
  • dzeme
  • dzetrtxbuk
  • e-commerce-app-verif-amaz-signus
  • e.hadiah2021freefire
  • e354354
  • e4mrl5a
  • e65ula
  • eabtraxyj
  • eadekvoz
  • eafppwmrzq
  • eajfikoad
  • eaquantumhq
  • easydinners
  • easyviz
  • eba1
  • ebbgofgcdv
  • ebhqhqgtgj
  • ebooks29m
  • ebooks7
  • ebooks86f
  • ebookscvd
  • ebookusespt
  • ebookusexon
  • ebookuseyba
  • ebookusezw2
  • ebookusf0g9
  • ebookusf7bp
  • ebpysbcvaj
  • ec2mvr
  • ecg7vrwyx
  • ecgbeald
  • echkzvmjar
  • eckental
  • ecosistema69
  • ecvaajaycs
  • eddiehomelab
  • edicil96-oci-e2-b
  • edorwhiwin1005
  • edsf2dti
  • eduardojardim
  • edubarcellos
  • eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee.duckdns.org.aikoviolet
  • eegkyjprdx
  • eeruayspeh
  • efasab
  • efetnklkzy
  • efuvgvqbdi
  • efzquleugn
  • egasxzatgxc
  • egejrvbulz
  • egemene
  • egeomor
  • eggjuysenb
  • egutgwtkrx
  • ehc5174sv429
  • ehhcrxtsmt
  • ehuauoaatfzu
  • ehvezqejiq
  • eiksa
  • einnbcc
  • eitkwjvjel
  • ejdhwylubq
  • ejgjui
  • ekan90in
  • ekcpvzdzli
  • ekekfdspb
  • ekjusruplo
  • ekmrbivdug
  • elanzici
  • elchibraxdur
  • elcoce
  • eleadul
  • electroplax
  • element.corneforos
  • eliaselofphoto
  • elizabethgk6623
  • elli75proxcert
  • elplan
  • elsclan
  • elvlnyofld
  • elzcfmfxvx
  • emad
  • email3329948
  • embaervutt
  • emburpo
  • emby.ramwerk
  • emeraldempire
  • emfkjvdppb
  • emiller
  • emmettaerynn
  • emnxmzokfr
  • ems-9c9aeb29.elkrammer
  • emszady
  • emytnvtesd
  • enajoejwwo
  • enannew
  • enceli
  • enduringworld
  • ener50burg
  • energyhealer
  • enin98fe
  • enonhe
  • enonsum
  • enpocchoo
  • eohctnpcqu
  • eonrelay
  • eorprrs
  • eotxtudsmj
  • ep2npv
  • epgtgsredq
  • eqagiygihp
  • eqgoub
  • equinsoocha
  • erafon
  • erfhgyu
  • erhard
  • erikssonjh
  • ermia
  • eronet
  • ertdfvzxv
  • esabon
  • esdesmond
  • eseqko
  • esjmrdepxp
  • esymwqrvng
  • eszndrztbp
  • etamqhttha
  • eternalsailormoon
  • etra-hunter-patreon.saychum53soft
  • euirjhd
  • eulatufpbz
  • eup8
  • eurekalan
  • eurevjum
  • euyaypim
  • evbore
  • evdxtgdley
  • evendfreefire728us
  • event-4anniversary-garena
  • event-agustusan-gratis2021
  • event-bundle-dari-garena671
  • event-codashop-freefire-2022
  • event-codsashop-allgame747
  • event-colektor22
  • event-diamond-codhashop-garena876
  • event-ff-gratis16
  • event-freefire-ramadhan
  • event-freefire-terbary2021
  • event-freefire.terbaru-indonesia
  • event-freefireffm
  • event-garena-ff153
  • event-garena65
  • event-garena773
  • event-garentot0x
  • event-gratis-diamond.coda-resmi089
  • event-gratis-freefire-gratis21
  • event-mobile-legendss-2022
  • event-pubg-com
  • event-resmi-gratis0606
  • event-specal-28
  • event-spinjuli-82
  • event-tinju-new-gratis2021
  • event.free876
  • eventcastre8924
  • eventclaimgratis-2021
  • eventcodashop2021
  • eventcodashop56
  • eventdaribangbudi
  • eventfreefire-21
  • eventfreefiregratis22
  • eventgarenaff-newspin
  • eventgratis71
  • eventmidasbuy
  • eventmlbb-m3-vv
  • eventnewff2021
  • eventsfreefiregratisclaim
  • eventspesialagustue
  • eventsterbaru-ff78
  • eventt-ff-indo-gratis
  • eventterbarugameindonesia
  • everdrup
  • everts-ha
  • evfogvyhko
  • evjfhnywhu
  • evrak
  • ewfogsauiu
  • examen-proxy
  • exempi
  • exiner
  • exocefim
  • expensivepdfmobi
  • expressams
  • extuwrthju
  • eykuwxevwu
  • eypz
  • ezmwijpmdx
  • ezpkxcqpxh
  • eztrghfg4j78
  • ezugi
  • ezura
  • ezxmxzvwax
  • f0rm4x
  • f2vltlw7
  • f3hj7wxq
  • f3taxuk8j
  • f6dsbg2oi
  • facebooklol
  • facepunch
  • fackohas
  • facuesrionarcuesr
  • fafofpod
  • faimonnoy
  • fajar2
  • fakavcblhn
  • fakoreis
  • fakup
  • falksvault
  • fall-risk
  • fambien
  • familiedoge
  • familyboult
  • fanfanbachy
  • fangio29
  • farite
  • farmroad
  • fastdade
  • fastservicepay
  • faststore104
  • faucati
  • fbbknesztm
  • fbdviw
  • fbkepo
  • fbwatchxxx30
  • fcfhdfkqrm
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.diamond-gratis-dari-codashop99
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.moreje
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.mtbilli
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.my1-members1stfcu
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.nfx07i0-updaite238
  • fd8a7ef9-faae-4c3c-814a-376eb024783e.random.ssecure8n-netflix
  • fdcloud
  • fdcpxwlauc
  • fdeljjjdvb
  • fdewtspnmd
  • fdhayzwq
  • fdsgbovzau
  • federzvz
  • fedor-stjohndc
  • feedbuzul
  • feedbv0dv
  • feegk
  • feeo5
  • fef2gfrg
  • felipesautosaleswww.backup.dianji
  • felixuni
  • felixvinas
  • feminineywu
  • feqmuejruk
  • ferdinanddubuy
  • ferri78cal
  • fewlisavw
  • feyud
  • ff-claim-item-net
  • ff-event-lootcrate
  • ff-evnt06-com
  • ff-gggamevo7y
  • fferivap
  • ffiecpltne
  • ffilmsxyw
  • ffilmszrn
  • ffilmt339
  • ffilmt3ry
  • ffilmt586
  • ffilmt5xa
  • ffilmt9x8
  • ffmax-terbaru2022claim
  • fgfkndjnu
  • fgidcqwysr
  • fgxfzz
  • fgxxywozdt
  • fiaswisdim
  • ficvv
  • fif1cvu6
  • fiiywfzsez
  • filebussy
  • filechecklive
  • filmdotavqtc
  • filmdotavsmh
  • filmdotavv7n
  • filmdotavxki
  • filq5
  • finkbot
  • firelock
  • firmware-mtk-6589.woodti88in
  • firmware-via-debug.imin13rol
  • first-release
  • fisidmi
  • fiskpinnar
  • fiswmdfjar
  • fitodido1234
  • fitzteva
  • fjahpkvszz
  • fjdpwggeej
  • fjmg
  • fjsoluciones
  • fjxftpqdbo
  • fkhz1yblogei3sk3g08upmxen2yrj25537a92q1sf0b1yzaidj9mlhtbxevw4yx.thonnunglu
  • fkkfkzqwcc
  • fkydecnzqo
  • flcxqcjamo
  • fleettowingservices
  • flex24
  • flibgcigqg
  • flietfnqri
  • flipse
  • floxide-jdr
  • fls-na.amzn.gin.superfolder
  • flsvialink
  • fluxnas
  • flycalex
  • flysky
  • fmdiaznube
  • fmhomelab
  • fmjvguraev
  • fmlwxmhvcf
  • fn15o3fknm
  • fnpbnijpyk
  • fnrkqriehy
  • fobijleota
  • fojexoej
  • foqnegtwuk
  • foqqvmfwwe
  • forcores
  • fornal-ombi
  • forrestroad509
  • fortitekbookstack
  • fortnbooksni
  • fortnbooktfi
  • fortnbool35f
  • fortnboole0v
  • fortnbooledj
  • foryou03
  • fotch
  • foudcsupkx
  • foundrymte
  • fowl-media
  • foyrumi
  • fpbpmsflbz
  • fplowwwgni
  • fpmfarccat
  • fq76t4unn
  • fqbfysglvl
  • fqingazure
  • franciscanism
  • frankcalls
  • frantic-home
  • franwolf89gia
  • franzen0328
  • freddanaborg
  • free-claim-hadiaj-disiji
  • free-fire-events
  • free-fire-gratiss14
  • free-fire-real.hadiahtiktokfreefire
  • free-fire-spin101
  • free-fire22
  • freefire-bgid
  • freefire-codashopvip7
  • freefire-garenanjk
  • freefireclaim2024
  • freefireefreeeventsgarena
  • freefiregrtis09
  • freefireitemfree2022
  • freefireoldgratiss10
  • freeklemm.freeeklim
  • freeskinz
  • freesultanxff
  • fremczpg
  • frenz
  • frisnvr
  • fritzbox.unraidstorm
  • fritzcarega
  • fritzdns
  • fritzhomevittyillo18
  • fruitboy1-scprime
  • frzvjl
  • fsoares
  • fsqccervlt
  • fsxqlftlst
  • fth5nf-sellsecu03
  • ftp.asj172
  • ftp.whitlock843
  • ftvybmwnsw
  • fudykjpyio
  • fujihouse
  • fumhrdjkxg
  • functenpi
  • funnypage
  • fusion.samcro1967
  • fuwaoqvo
  • fvfoxnbu
  • fvklqmqrqi
  • fvsdg
  • fvvshark
  • fvw
  • fwd9k0w3
  • fwnednwkkj
  • fwsrbyca
  • fxilfjrgxo
  • fxvewuaqag
  • fykqxdqibn
  • fymxfqkfgr
  • fz0aoqepggk9acer2xwi4nzde1onqqgiuj2mvmq5
  • fzdjevskkr
  • fzmmtoufbg
  • fzonevpn
  • fzspatalon
  • g1p
  • g4z42o92z
  • g5fd54g5dfg45fdg
  • g6uu10
  • g86ypw
  • gaboautomation
  • gabunggrubbokepviralterbaru
  • gabunggrubviral-chika
  • gabunggrup-v2
  • gaditamanipulats
  • gaelit07
  • gagolife
  • gagtxw
  • gaibodar
  • galaxy-survival
  • galigrue
  • gallikersweb
  • gamenomarena
  • gaom
  • gardalab
  • garena-bagi-bagi-hadiah-gratis-2021
  • garena-event.free-firexxdd
  • garena-ff1
  • garena-ivent-spin619
  • garenafreefireclaim1134
  • garenafrefire
  • garnock
  • garver
  • gasxazte
  • gateway.yikong
  • gaxoswof
  • gay-nsfw-patreon.umbu77chie
  • gazbijijow
  • gbecdupvfd
  • gbirwlkznn
  • gbmr
  • gcp12
  • gdjzvigrbr
  • gds.hajdel
  • gds.oracleseoul
  • ge8ppi14s
  • genramus
  • georgiana
  • geotranar3
  • gep
  • gepvihfpgp
  • gerd57
  • gescars65toy
  • get-now
  • getflkba
  • getflln8
  • getfloy2
  • getflqi3
  • getflslg
  • getflssk
  • getflstu
  • gfvdsco1
  • gfvdsdaa
  • gfvdsdn3
  • gfvdsevg
  • gfvdsfnj
  • gfvdsfzp
  • gfvdsh9b
  • gfvdsj7d
  • gfvdsmz9
  • gfvdsoze
  • gfvdsrbn
  • ggoyzdleeq
  • ghetan32oc
  • ghin91
  • ghmldilwfx
  • ghzsortapn
  • gianggsd
  • gibbs-protegewx
  • giesysdi
  • gietnaad
  • gigimimi
  • gilproxy
  • gilshomelab
  • ginher
  • giomudpost
  • gionsagricoleagrci
  • gioulofi
  • giroque
  • girstack
  • gistbucket
  • git.git.cometacts.support-mtb
  • git.git.git.cu4capryitclygy8.myfritz.neter.coms.detmer
  • git.git.git.git.git.git.drupaldemos.combewww.sts.detmer
  • git.git.git.git.rumusdt.com.sts.detmer
  • git.git.git.gitlab.git.gitlab.gitlab.direct.detmer
  • git.git.git.mta-sts.dedaza
  • git.git.git.vedor.nlgitlab.dkpato.xyzw.sts.detmer
  • git.git.gitlab.brightacf.como.xyzw.sts.detmer
  • git.git.gitlab.git.com.sts.detmer
  • git.git.gitlab.git.gitlaest.3ntity
  • git.git.gitlab.git.paesemoraes.selecao.sitetos.es.detmer
  • git.git.gitlab.gitlab.git.gtrfderso
  • git.git.magento2.weltevrng.dnsovh
  • git.git.tamamengineering.zendesk.comer.comeus.detmer
  • git.gitlab.git.git.gitlab.gitlab.symbiotek.fr.detmer
  • git.gitlab.git.git.gitlab.regenerujeme.skus.detmer
  • git.gitlab.git.git.hqgaycock.com.comitets.detmer
  • git.gitlab.git.gitlab.clemaptetatilo.tkzw.sts.detmer
  • git.gitlab.git.gitlab.git.git.git.comme.com.detmer
  • git.gitlab.git.gitlab.git.git.longinos.es.detmer
  • git.gitlab.git.gitlab.menuetoriental.comets.detmer
  • git.gitlab.gitlab.gitlab.alexahner.derg.eus.detmer
  • git.gitlab.gitlab.gitlab.cannacoin.wikianglberg.detmer
  • git.gitlab.gitlab.mail.dashboard-rectify
  • git.tocts.support-mtb
  • gitlab.giit.ff-evnt-com
  • gitlab.git.dubai.redcat.rume.comts.detmer
  • gitlab.git.git.gitlab.git.canningwithcolette.comsts.detmer
  • gitlab.git.git.gitlab.gitlab.gitlab.togepivpn
  • gitlab.git.git.gitlab.spaceosystem.com.pls.fr.sts.detmer
  • gitlab.git.git.guy3.xyzgit.calzzapato.xyzw.sts.detmer
  • gitlab.git.git.motork.ioeuvk.bestmbaiku.idts.detmer
  • gitlab.git.gitlab.geekstreethosted.com.sts.detmer
  • gitlab.git.gitlab.git.git.git.gitlab.dirokasze
  • gitlab.git.gitlab.git.gitlab.gitlab.comusdt.com.sts.detmer
  • gitlab.git.gitlab.gitlab.gitlab.codashop-ff-bgid
  • gitlab.git.gitlab.polkitr
  • gitlab.gitlab.git.wanywa01.comb.git.pls.fr.sts.detmer
  • gitlab.gitlab.gitlab.visaka.sitekiesdress.coms.detmer
  • giulioprova
  • gizhcloud
  • gizudyoy
  • gj77hnk5
  • gjrcucln
  • gjvczmulcz
  • gjzt5t95x5p0buvi.vnwiki
  • gkbhjnlsyu
  • gklees
  • gkmjdtjali
  • gkvbzadpbt
  • glbbzlvvuu
  • globabril
  • globalsurvival
  • globaltechha.tkdrob456
  • globalvpn
  • globexdilint
  • glxplnrhrx
  • gmanastro
  • gmhmxouldv
  • gn148q
  • gn8x5k
  • gncfwgovtg
  • gnekpexzrl
  • gnr092mine
  • gnsiva
  • go.hawkmielle
  • goaremes
  • godamner
  • gogifo
  • goisrt7ghygeo9fd
  • gol700
  • golden-reporter
  • golkit
  • gomsal79
  • gonzafamhs
  • goochengineering
  • gooffice.truenas12
  • googlehomethanh
  • gopnik06
  • gotify.flashbackhome
  • gotify.theaskervps
  • gotshouse
  • gpbbegaadp
  • gpjshxgzdt
  • gpkfgdikim
  • gpnwhabodc
  • gpsgateserver
  • gpup814k
  • gqdrdlmuxj
  • gqer237
  • grabnow0
  • grafana-amer
  • grafana-loki.mini-nomada
  • grafana.brandenburger
  • granadje
  • grants-pass
  • gratis-dm29
  • grav.kisaacs
  • grcefkg4
  • greasylab
  • grfcob
  • grinds
  • gringl
  • grlvfsnozk
  • ground-towards
  • grovrf
  • grub-indo-viral-2022
  • grup-bokep-simontok
  • grup-bokep-viral-616
  • grup-wa-okep
  • grup18hot.grupbokepbaru
  • grupbokeh2022terbaru
  • grupsxx1
  • grupwa-bokepjandamulus
  • gs1mak1202
  • gseskjwjvj
  • gsfnbvhbyh
  • gssockmusd
  • gtgratis
  • gtomnqxlee
  • guacamole.n-dietrich
  • guatemaltecan
  • gud408
  • guerida
  • gui-nina
  • gui.qutlook
  • guichanism3
  • guidepdfi28
  • guidepdfow9
  • guidepdfpqd
  • guillaumer
  • gujovnim
  • gukwjgk
  • gurnohy
  • guttermonk
  • gvbneblvht
  • gvtmttgxru
  • gw1
  • gwemdyif
  • gwileczka
  • gxccpapoad
  • gxp
  • gxtkpvzgmp
  • gyebimi
  • gygkrtkmna
  • gykbdthhfd
  • gylipawn
  • gynedxzknr
  • gyseper
  • gyzturfczj
  • gzejfikyjg
  • gziciywcxv
  • gzsvkbwgae
  • gztkjtxzbq
  • h1v5x5pdrf
  • h4sk33rhoa
  • h5gt0
  • ha-jact
  • ha-ksho
  • ha-mirlaine
  • ha-nightshademanor
  • ha-r4phab
  • ha.54m
  • ha.bigzh
  • ha.lassesmcserver
  • ha.moonstarry
  • ha1ichou
  • ha4iot
  • ha666
  • haaer
  • haberstroh
  • habnenana0906
  • hacantuad
  • hackeipc
  • hacker665
  • hacor8400
  • hadiah-freefire-indoensia-gratis
  • hadiah-oktobergratis-nohoax
  • hadiahbuatkalianisidenganbenar
  • hadiahgratisanff2021
  • hadianki
  • hafcon
  • hafizhcloudasiaa
  • hagall-aws
  • hahahaho
  • hahay-test
  • hahnhome
  • haillucifer
  • hajav
  • half-asleep
  • halilford
  • halory
  • hamdibaba
  • hamis
  • hammqtt
  • hamonitor
  • hamsto
  • hamsung-3bb
  • hamysweethome
  • hanbero
  • handbrake.mizzou-tigers
  • handbucn4
  • handujarrwordpress
  • hanmt2
  • hanto
  • hape1
  • haplites
  • haraeddf
  • harderlivingaudiobookshelf
  • harrulor
  • harvey
  • hasam33
  • hasouppes
  • hass-cloud9
  • hassio-acoll
  • hassio.3villanhom3
  • hassio.trelde
  • hassiocasalisb
  • hassiolra
  • hassosso
  • hawaibghitn9ol
  • hawettsrv
  • haxx
  • haybarnkent
  • haz5py
  • hb-quickbooks2
  • hbgzwcyukh
  • hbpeszjeiq
  • hbpnet
  • hbskdczkhw
  • hc1839
  • hcpvbawikx
  • hcryzv
  • hdbctxmlci
  • hdontkzsjq
  • hdqccuyzxa
  • hdshdjk
  • hdtjlotv
  • headscale8oss
  • heat-and-transfer
  • hebernpm
  • hector27
  • hedecloud
  • hedric
  • hehljszwso
  • heia
  • heiden
  • helen7rp0832
  • hell77
  • hellocody
  • hellokenny
  • hellolocal
  • help-feedback2-appie
  • help-support-office235
  • helyys
  • hemozoon
  • henkplas
  • herbalouymag
  • herbstblatter
  • heroldow
  • hetcaret
  • hexamc
  • heygotanygrapes
  • hfbeghkeig
  • hfeivipovt
  • hfish.salvasacie
  • hfscddqppv
  • hgaelii
  • hgjghkhgk
  • hgjgkfkrk
  • hgoaueilbn
  • hhdwvqcgfg
  • hhonmhvupg
  • hi-from-melb
  • hidanmine
  • higidreams
  • hiqxkzflmr
  • hirushafra
  • hiscikpout
  • hjbaguidwo
  • hjkipsg
  • hjkj3vr
  • hjortestien61
  • hjsdhjdsjhds
  • hkfqqekzrd
  • hkloxrshet
  • hktweber
  • hlmqixxjji
  • hlvmdeilkh
  • hlvmxizspi
  • hmc-has
  • hmiwp3
  • hmqt
  • hmrbsmodjn
  • hmufyvpxjb
  • hn02
  • hnahglulvt
  • hnizdecko
  • hoalanhoang
  • hoetinghass
  • hohbtlmrhy
  • hohoangan
  • hoihmakqwn
  • hoken
  • holyhomeassistantnetworkhome
  • home-koki
  • home-littledev
  • home-pipitch85
  • home-zaks-io
  • home.1z491pp
  • home.sturgishomeassistant
  • home01server
  • homeadmin.swotai
  • homeasscelardo
  • homeassistant-fkn
  • homeassistant-kuchar09
  • homeassistant-yannikschirm
  • homeassistant.homelab-kiliboz
  • homeassistantksarhome
  • homeassistxp
  • homeauto8585
  • homebrestassistantloca
  • homebzz
  • homefibre
  • homegst
  • homejlmt
  • homenat
  • homepanel.kjorlaug
  • homepatvpn
  • homeservr
  • hometechmoon
  • homevlc
  • homeworkdfsk
  • hominoid.black-v
  • honeyedly
  • hoojf
  • hookupuok
  • hookupwoy
  • hookupxor
  • hooq8
  • hoppmann
  • hoqqdotgnp
  • horizon1
  • horn-nas
  • host-wellspage
  • hotvideomexxico
  • housearunraid
  • housnihmlak
  • houston1200
  • houtwal
  • how-to-access-onlyfans-pictures-for-free.fiesa37back
  • hphomebox
  • hpwndwfslo
  • hpybqpcbuc
  • hqdoxzlzkn
  • hqlieiaulb
  • hqlpljlncn
  • hrpzrtcfcv
  • hsaiifbtbi
  • hsbshomeassistant
  • hskpaahtqa
  • htfiles
  • htfuujvvvi
  • htsxdkxoeb
  • httpschatwhatsappcomjemo9p7ebyf6rw
  • huangdi
  • hudsonmandi
  • hudstmygvw
  • hugdoophzl
  • hum4nsh1eld
  • humanists
  • humla
  • hunger-stores
  • hunterlee
  • hvbor
  • hvnzhglleh
  • hvsdcgthjk
  • hvuazrtbwm
  • hvupqrrsst
  • hvyjjotjaa
  • hwfcolprzy
  • hwgkdfxdmn
  • hwzqjxjqix
  • hxgrnfhbed
  • hxwpefdyzs
  • hyhkkj
  • hyhpbkrlsn
  • hyperoffsite
  • hyryifgtjz
  • hytwjpzilv
  • hywqyiuo
  • hzj70t
  • hzonurj
  • hzoqasarrr
  • i-apps
  • i-disappear
  • i2rbitk
  • i8yf9oi8u
  • ia5tnk
  • iaaa
  • iamb-smarthome
  • iammagash
  • iamoakeytonido
  • iannelli
  • ibagqnpxtn
  • ibexis
  • ibiuctifnq
  • ibjjaspblz
  • ibpchkrlap
  • ibpmu269
  • icinneu
  • icloudwebtor
  • icnectoo
  • icnovqwpjs
  • iconicskies
  • icsebe
  • icuchie
  • icwjspcy
  • icyztv
  • idgmfg
  • idizafyxdv
  • idontknow
  • idthkaaxer
  • idzitbwyeo
  • iefunwan
  • ielstikel
  • igcgnlnymc
  • igeekomx
  • igflzmsuzd
  • igokocejgh
  • igpteenvwa
  • igv-villaggio-baia-samuele
  • ih19l98c
  • ih6nic7s2
  • ihfdnyzipm
  • ihilvjcurx
  • ihj2qmi
  • ihmywzfufl
  • ihtvny
  • ihwkwi
  • iibahcepbb
  • iiilll
  • iina8qvt
  • iincatgazq
  • iiwjjjwjii
  • ijamerjnez
  • ijmgauilux
  • ijyzgghunz
  • ikjwgisyaz
  • ikthlieeyw
  • ilakhar
  • ilar19as
  • ilbvcxyksv
  • ilgkseipfr
  • illene
  • iloveyouuu
  • imap.apachelab
  • imap.t10a263
  • imbiwhym
  • imdravohon
  • immich.josevega
  • immixes
  • imrklbauzl
  • imrytpi
  • imsbdnprxz
  • imsphome
  • imunge
  • inamwon
  • incommode
  • incorporateddesignfirmwaresdell
  • incretedy
  • indonesiahot
  • inevitable
  • info.nijokasidu
  • info4412
  • infobadmc
  • infocomm
  • infojulie
  • infoo1742
  • inforbtusers
  • inhgtpotbgstxat
  • inhumantn
  • initiare
  • inmoapp
  • inpato
  • inpreqre
  • inraiza
  • inraxocyzi
  • insane20
  • inserts
  • instantnyc
  • institutojmj
  • int-servics-emt
  • interca
  • intersected
  • intranet-ccbfoz
  • inunstoud
  • invalid69
  • invbest
  • invidia-nas
  • invitegrup-wa
  • iohufjeq
  • iojxhclnqw
  • iopi
  • iotlabtuke
  • ioy2hmw4y
  • iozipsypba
  • ipaxgquscz
  • ipcclpducx
  • ipktapftvs
  • ipstream2
  • iptvfilm
  • iptvsl1
  • iq3vi
  • iqwicgqavh
  • ir6
  • irebesterintsu
  • iriscope
  • iroas
  • irpoat987
  • irresistance
  • irsoft
  • iruaxezuqw
  • iseb-assistant
  • isidcal
  • isimsiz-turk-tumblr-com.sumply12vau
  • isinfsqtzq
  • isogenous
  • it.claim-item-new-x1
  • item-baru-agustus
  • itemmlbbfree
  • itflavan
  • itgamer
  • itiwana
  • itsmydomain
  • itsupen
  • itts
  • iuda5
  • iujasgig
  • iulailinextcloud
  • ivdicons
  • ivfwacchoq
  • iviqelzcsn
  • ivital
  • ivjhszzrxi
  • ivmaiglyc
  • ivohome
  • ivqwdvksua
  • ivydrive
  • iwwbrkxqcx
  • ixemfhltmw
  • ixeoudcjkv
  • ixgovkraxv
  • izvkbvtdiy
  • izz2
  • j26g59hx
  • j4g0ks48ana
  • j4m
  • j9q3xt
  • jacenarq
  • jacez
  • jachig73
  • jacksnake
  • jagalive
  • jagqhqxgud
  • jahife
  • jaimepiso1
  • jakesh
  • jamieralph
  • jandpnewbyhome
  • jardiance
  • jasaji
  • jaseafile
  • jbarm
  • jbcvha
  • jbeira
  • jbfldpifkw
  • jbitsvoumr
  • jburger85
  • jcmrqngeyv
  • jctnwosuej
  • jcvnhv
  • jcwkqwctle
  • jcxtniczec
  • jd16home
  • jdbfxksvsf
  • jdfhrizmlr
  • jdhflruebw
  • jeeywsiqab
  • jeffk
  • jeidi
  • jelly-perseo
  • jellybean1967
  • jellyfin.hoodhost
  • jellyfin.onkarhome
  • jellyfin.patoots
  • jellyphil
  • jeypuq
  • jfjdiarusi
  • jflopkaspj
  • jfsht7x9x
  • jftexdxllq
  • jfwkvvpwse
  • jgewy61
  • jghoxoxduh
  • jgmlpeafuao
  • jgpesca
  • jh526qsd66dfg62fgh
  • jhegw
  • jhpslswwqc
  • jhrotsscflwb
  • jhzejjeiak
  • jimsrouter2
  • jinnme
  • jiqu
  • jitsielguimar
  • jivkziyyzq
  • jizoye
  • jjcivcwxod
  • jjomha
  • jjspopol
  • jk.nkmserver
  • jkanliqwll
  • jkiddserver
  • jklighthouse
  • jkmovies
  • jkombi
  • jks-server
  • jkyg2ydc
  • jkytdudcmi
  • jlopdhurce
  • jm36
  • jmarais-id
  • jmhnqqdhbd
  • jmixbrelsi
  • jmkryykvpi
  • jmolina
  • jmxaqbiaas
  • jmxlavbxjv
  • jmzisrtdgi
  • jncnc
  • jnhrewbbbr
  • jnimos
  • jnlayeyxrl
  • jnpkdorqqs
  • jnvyxfillx
  • jobafyjiyf
  • joeljohnston
  • join-grub-janda-lonte-terbaru
  • join-grubviral2021
  • join-grup-dylan-pros-01
  • join-grup-sexy-tantesange-autocrot
  • join-grup-viral251
  • join-grup-wahtsapp-viral
  • join-gruptante18
  • join-grupwhtsapp-bokep
  • join-whatappsnews
  • joingrub-waneww
  • joingrubwa9
  • joingrupwakaka20212
  • joinmygrub715
  • joinwhatsapp-grup
  • jojgrzddkq
  • joker
  • jomher
  • jomnithe
  • jonbc
  • jordangratis.allitemgratis
  • jorrbajpvi
  • josempbp
  • josevillaio
  • joshuas
  • joshuasite2
  • joshysthing
  • jossestarr
  • jotra
  • joustteamspeak
  • jowuhhe
  • jp-tube-gqnk
  • jpbchat
  • jpbfctfqot
  • jpicondevtest
  • jppldvmnss
  • jprwaqdnxp
  • jpuqop
  • jpvddns
  • jqpttrtftw
  • jrloforgqy
  • jrtutzgtue
  • jryrnaehwq
  • jsdm
  • jsxahcieuu
  • jtasseroul
  • jtbmajbgcn
  • jtsu
  • juan-rosell-libro
  • jueclrkqrc
  • juegas-con-mi-mente-descargar
  • juego-pou-para-descargar
  • juegopong
  • jujtvwqwen
  • julevarmt
  • julisn
  • junsun-910-firmware.kbaces21ac
  • jupyter.pulpo
  • justinemicka
  • jutsfrrqpb
  • juzhwxkkic
  • jv7u0rj8ne0avb0r.duckdad
  • jv9pjz
  • jvantorre
  • jvnwwbib
  • jvpjdyousz
  • jvqjnnspkc
  • jwcqobvxly
  • jxatnszgaq
  • jymiokjymn
  • jynvwwrzyj
  • jzhvymetal
  • jzt4s3zqc
  • jztkuwvypn
  • jzxwvurgec
  • k-castle
  • k-glover
  • k0rea82
  • k13
  • k1myowa0
  • k4ng
  • k82ra19i
  • kacane
  • kaether
  • kafyorfjei
  • kaichang123
  • kaigrassnick
  • kajucuap
  • kakzardengi
  • kalione
  • kancawa
  • kanieldasperhome
  • karhose
  • karlzre
  • karthik85
  • kasmworkspaces.tormnt
  • katastrophal
  • kato-home-ngmr
  • katov32d6
  • kaungmyatthu234
  • kayyybear-patreon-leaks.childcer31ne
  • kazwmackvv
  • kbdwytkoft
  • kbevrdudjd
  • kbhnfifththirdbnkhld
  • kblkfwlnbq
  • kblytkbdcp
  • kbvpkekgar
  • kckaperkkw
  • kcunpltgbs
  • kdenxpntyf
  • kdjbnizyjq
  • kdkxaqdajf
  • ke.fonte
  • kean
  • kecijbupvlpudvlk
  • kedtrmrbmj
  • kelokun
  • kelvinty
  • keotarre
  • keundol
  • keuwcjd5u
  • kevancolena
  • kevinbaijnath
  • kevingvr62
  • keylisno
  • kf637
  • kfhsddbfib
  • kfpjqzlyeb
  • kfxnpdipvl
  • kgrgnrhzmd
  • kgsncafvcc
  • khancloud
  • khanguyen
  • khh5d2
  • khhcajmkma
  • khoeknrgot
  • khonfileserver
  • khotsojdvcal
  • khptuzyzis
  • khzxztgdjw
  • kicurtcwad
  • kidram
  • kiim
  • kikreehome
  • killav1s
  • killawog
  • killaxdp
  • killayfr
  • killayj4
  • killb1mi
  • killb2cz
  • killb51y
  • killb5o4
  • killb6m6
  • killdeerha
  • kimberly7vs9v
  • kimhome
  • kimodyotxi
  • kingdomicon
  • kingjomzac
  • kinobog
  • kintonffmbck
  • kinveachy
  • kirasan
  • kirtyuebooks
  • kitesmak
  • kitiya01
  • kiurusgl
  • kiznannse
  • kjiudc1kf
  • kjwwjocpop
  • kk1gxk
  • kkgk1241
  • kkihg0l0
  • kkihg3t8
  • kkihg4qo
  • kkihgb48
  • kkihgc6z
  • kkooqbdhhe
  • kkpfsense
  • kl4475ig
  • klaim-skin-mobile-legends
  • klaimitemoldff29
  • klantendiensren
  • klaraja2023
  • klasde
  • kleinfee
  • klimeshke
  • klinkster
  • klipperx
  • klodespe-casa
  • klsrib
  • klvtzqqpeq
  • km3
  • kmit
  • kmudzwhfww
  • knav
  • knexnwawfc
  • knfejbrwwa
  • knowmaster
  • knvslocuti
  • knylmhhkoc
  • knz7dv703
  • kocolemew
  • kodi.mizzou-tigers
  • koertsiobroker
  • kokiluv
  • komga.spikevalantine
  • konto-uberprufung-amz-bacun121
  • konvallvegen
  • koopa
  • koralive
  • koramc
  • korg
  • korvudtnas
  • koryak
  • kostahm
  • koszyk
  • kotiohjaus
  • kouymfabdo
  • kovanraspberry
  • kpejurclql
  • kqkkx17
  • kqnbybvqxk
  • kqwgqkyigq
  • kr0mm3
  • kretw
  • kris91
  • krita
  • kronova-hassio
  • krueckehome
  • krzeevvngv
  • ksardfuyadiaugo
  • ksemydnvxc
  • ksrcshtgis
  • kthhnimokh
  • ktquimrnsq
  • ku0
  • kubargiz
  • kucasvijetla
  • kudthocy
  • kuejrfgaswbuz
  • kuhab
  • kulhdwnfyv
  • kulpfamily
  • kuma-skb
  • kumars
  • kunsnj
  • kurbandomain
  • kurhrcfmxt
  • kuzucuq
  • kvmavawkzo
  • kwgutkorib
  • kxgodlfhpo
  • kxkqbtsjlu
  • kxosznzrdc
  • kxzkjwglgi
  • kyleconley
  • kylian2009
  • kz75hxwxa
  • kzagba
  • kzaniscloud
  • kzn213
  • l1i84z8
  • l2-cloud
  • l337dom
  • l7s8qxu
  • la-vierge
  • lab-kedatk
  • labfa
  • lacasadimattia
  • lacompfatal
  • ladelap
  • ladomoticaesterna
  • lafuga
  • lagomera
  • lalaibci
  • lammergg
  • lampertico
  • langhamvpn
  • lanroge
  • laquiniela
  • larasi
  • larres
  • lasuf
  • lasx4mv
  • lasx6ro
  • lasx8i1
  • lasx8ph
  • lasx9zu
  • lasxahm
  • lasxdkv
  • latankci
  • latnife
  • laurapt22
  • laurensdehoorne
  • lawall
  • lawckjludz
  • lazandsue
  • lazulnib
  • lbgdqr
  • lcppvoljvn
  • lcxxdxlfsi
  • ldeqbz
  • ldprivat
  • ldxbkyuxpy
  • leateti
  • lectfrigem
  • leekor18
  • leens
  • leephadior
  • leeypzq
  • legacybuilder
  • legerity
  • leidenschaft-hund
  • leilrbadek
  • leitnerw
  • leiwand
  • lengyelviktor
  • lenini
  • leonard125
  • leoniq
  • lepgxtamwa
  • lesmagiciens
  • letharepoo
  • letoq
  • letvbddmpw
  • letzblockmilk
  • levery
  • lfotnemjhk
  • lfottm
  • lfzqfl8
  • lg18pfsense
  • lggn-mricrosftonline-c0m9ikr
  • lguafpcsps
  • lhksyddtuu
  • lhz46uh8av3muhesfanbkhvsedyuvhyymx
  • libabool21
  • libaboold9
  • library.crockantenas
  • libricum26
  • libricuol8
  • libricuopd
  • libricuqpu
  • libricuqql
  • libricuqw9
  • libricut6s
  • libricuttd
  • libricutwn
  • libricuvuv
  • libricuxev
  • libricuyie
  • libricv1u6
  • libricv2pc
  • libricv6yc
  • libsimetoh
  • libsmulgbs
  • libsqodatu
  • libsyap10r
  • licila
  • liesearchvi
  • lima
  • lindnagy
  • link-bokep-565
  • link-mediafire32
  • linkie21
  • linkmediafire-tantetante-77
  • linmght
  • lionelcris
  • lionssh-kiiddboil
  • lipzinternational
  • lirama
  • lirxxmxlcf
  • lisauw3165s
  • litetho
  • littleorange
  • livebook
  • lizzygganjay
  • ljusaqem
  • ljxfazjioq
  • lkbxmlersd
  • lkfsgnnskt
  • lkitsqzozs
  • lkmdmwrqwj
  • lkneatlzxp
  • lkvaxsiist
  • lkxtss
  • lkyorzggfa
  • llevqtfsja
  • llongoplex
  • llosrae
  • llosrxk
  • llosw53
  • llsvcmpqiz
  • lmrffk.duckdns.orglmrffk
  • lnfmtsguls
  • lnhjviddke
  • lnlywqzpyq
  • lockedamazonnd
  • log-in-7001115
  • log-in-77520
  • login-mobile-legend
  • login.tomickserve
  • login0-my-gov-au
  • loginetuwier
  • loginservice
  • logoygt
  • lolart
  • lolivxhtdy
  • lomrre-pdf
  • lonelyduck
  • lonxhwhsqa
  • loogizhjsd
  • loriscasa
  • losadons
  • louvering
  • lowgztzvid
  • lowkeylabs
  • lpayvsuzgz
  • lportos54
  • lqnzrvpsvb
  • lqqn-micrusoftonline-com0owa3sjk
  • lqyogexsgp
  • lr44enh
  • lrbukkdcrq
  • lrdptxwcek
  • lrsaxifn
  • lslatr
  • lsntffiaxp
  • lss225
  • lsussurgpg
  • ltdxpsonen
  • ltfxaosjbo
  • ltjiniesyf
  • ltsvfqzbvz
  • ltvqkyageo
  • lubkx2z
  • lucianicasa
  • lucky-frefire-gratis-23
  • lucky-spin2021news
  • lucky-spinfreefirefree
  • lucky2021-cobra
  • lucky96
  • luckyroyale-new
  • luckysim
  • luckyspin-freefire-gratis2022
  • luckyspin-resmi-freefire-garena0.duckdns.org
  • ludovic
  • lueddys
  • luginutu-nuturanwae
  • luisgomezftp
  • lujnvv
  • lukagtp
  • lulu22
  • lurchmqtt
  • luswlmzaas
  • luvhouse
  • lvarpecdhe
  • lwmha
  • lxcrangidv
  • lyc-pc
  • lycaki
  • lydxyy
  • lylikind
  • lynetta
  • lynhj8tr
  • lzgftfmeiy
  • lzvnfifgjq
  • m.esy6k7s3mopslpv4nbeful4.3ntity
  • m18ys85
  • m1c7o3o5t0n3c4alln0wv3r1fic4ti0n
  • m1ndd28
  • m41lboxx
  • m4el1
  • m58i8j
  • m8ukbe7m5g9ti11maihel6r3ojnz53vd2pohh9ifpqgy4aunah351a46wl4800a.sign-updateamazonaccountolmnlsa
  • m9eiutny2
  • ma.ourstorage
  • maakodu
  • maapuh003
  • mabnigo
  • macaighost
  • macnetic
  • macroeconomics
  • mad-star
  • madaracar
  • madmacher
  • madomsb
  • madrona
  • maelhmvuvb
  • magicfdp
  • maidisri
  • mail-tapcorp-kerio
  • mail.0000098701
  • mail.0004568702
  • mail.00054621001
  • mail.00062196413
  • mail.000909790
  • mail.001222106
  • mail.001262
  • mail.00235310
  • mail.0064523316
  • mail.0064547014
  • mail.0090081217
  • mail.0097230
  • mail.00connect-verifyinfous
  • mail.0112776121
  • mail.0119899015
  • mail.025490
  • mail.03private-authorize
  • mail.079333237
  • mail.0824117609
  • mail.091411321
  • mail.091411324
  • mail.0987654321120
  • mail.0nl1inever1ificat1ion
  • mail.0zxu0hlfneajgxycgg5m
  • mail.1-access-verlfy-user-bofa-css
  • mail.1000000014
  • mail.1000234984951
  • mail.1000234985227
  • mail.100034653615
  • mail.100084657416
  • mail.100155812805
  • mail.100496105118
  • mail.100588918903
  • mail.1006637413
  • mail.100775309511
  • mail.100814811511
  • mail.100835477507
  • mail.1009168917
  • mail.100946908911
  • mail.1011134984293
  • mail.1011134984803
  • mail.1011134984858
  • mail.1011134985069
  • mail.1011134985103
  • mail.1011134985221
  • mail.10141520212
  • mail.10145227916
  • mail.101524169209
  • mail.101843749417
  • mail.101902568603
  • mail.101943581412
  • mail.101952242419
  • mail.102028652217
  • mail.10219658211
  • mail.102228128112
  • mail.102313085308
  • mail.102744648615
  • mail.1027575118
  • mail.102847956614
  • mail.103142512803
  • mail.103311998302
  • mail.103481416715
  • mail.10349815206
  • mail.103603491215
  • mail.103623558611
  • mail.103623558617
  • mail.10366290820
  • mail.103785274414
  • mail.10407081
  • mail.10454564525
  • mail.104583291520
  • mail.10466313804
  • mail.104830
  • mail.104914321101
  • mail.104927429115
  • mail.104936031917
  • mail.104999672413
  • mail.105201539501
  • mail.105222757712
  • mail.105282575411
  • mail.105320038215
  • mail.105342691702
  • mail.1062068902
  • mail.106240038406
  • mail.106392468906
  • mail.106403169113
  • mail.106666244512
  • mail.106767185516
  • mail.107463968418
  • mail.107472718412
  • mail.107770272501
  • mail.108030571101
  • mail.10820761806
  • mail.108772347120
  • mail.1095721803
  • mail.109574654714
  • mail.109763388613
  • mail.109856632318
  • mail.10993750214
  • mail.10997842504
  • mail.110841182203
  • mail.110958138202
  • mail.110960727219
  • mail.111034954704
  • mail.111111123219
  • mail.111233318212
  • mail.111303082212
  • mail.11198457406
  • mail.1119980805
  • mail.112139225120
  • mail.112143240901
  • mail.11219250701
  • mail.112211351520
  • mail.112922363916
  • mail.11306087515
  • mail.113179213705
  • mail.1156738413
  • mail.115880440209
  • mail.115880440211
  • mail.116225831313
  • mail.116612451813
  • mail.117929575819
  • mail.118134721915
  • mail.118192721205
  • mail.118347652505
  • mail.119476791113
  • mail.119536142501
  • mail.119824
  • mail.120405004718
  • mail.120488949702
  • mail.1209120935
  • mail.1210911905
  • mail.121209865
  • mail.12143421
  • mail.121448367811
  • mail.121654321011
  • mail.122114777514
  • mail.122165847503
  • mail.122844114114
  • mail.123456514
  • mail.123731811916
  • mail.124752900617
  • mail.12659079401
  • mail.12786584318
  • mail.12923618504
  • mail.13758245320
  • mail.140948028514
  • mail.143301225320
  • mail.14837118908
  • mail.150842284908
  • mail.152430529416
  • mail.1535160
  • mail.154551219133
  • mail.154551219237
  • mail.154551219478
  • mail.154551220326
  • mail.155188156615
  • mail.15552007
  • mail.156484867215
  • mail.157448631216
  • mail.157740107508
  • mail.162198189412
  • mail.162198189417
  • mail.16536238615
  • mail.168911964112
  • mail.176021442508
  • mail.179455999111
  • mail.179455999114
  • mail.18pluss9
  • mail.191310152801
  • mail.19200711
  • mail.19200747
  • mail.19200751
  • mail.192536954786243
  • mail.193680146303
  • mail.194kuotagratis
  • mail.195575853909
  • mail.1m1tcb-00033i-cn
  • mail.1ms4oy-00055p-72
  • mail.1mvni0-0000ue-kb
  • mail.1mxkqu-0000pv-3i
  • mail.1mzyw1-00050b-ro
  • mail.1n5zqv-0005pm-cx
  • mail.2.new-garen92
  • mail.200035019
  • mail.200928112316
  • mail.20212320
  • mail.202921716412
  • mail.21006525
  • mail.21321412119
  • mail.222034795815
  • mail.222142141239
  • mail.222345687208
  • mail.22456402
  • mail.227068978203
  • mail.2323282
  • mail.23333214
  • mail.234555702
  • mail.235653455627
  • mail.25869871701
  • mail.25895200014
  • mail.260112244111
  • mail.265080260614
  • mail.267754046707
  • mail.269565846719
  • mail.27-event-ff-new-gratis-2021
  • mail.273168169309
  • mail.278649362810
  • mail.280000008
  • mail.280635495320
  • mail.284693888707
  • mail.28534r
  • mail.28888000004
  • mail.292wagrup
  • mail.30045637
  • mail.30332563589600
  • mail.309088713022
  • mail.32109910238435
  • mail.32109910238472
  • mail.32109910238593
  • mail.32109910238826
  • mail.3215401
  • mail.323388637602
  • mail.323389773
  • mail.324234223
  • mail.3268792404
  • mail.3268792409
  • mail.3326564589418
  • mail.333451232
  • mail.3335774
  • mail.33905442
  • mail.345225089407
  • mail.347738769409
  • mail.349572741812
  • mail.353546464524
  • mail.353646302
  • mail.3537645801
  • mail.361115863911
  • mail.364758218
  • mail.364758296
  • mail.367648791244258
  • mail.369980863107
  • mail.393874656484306
  • mail.3ch2se-secure
  • mail.3hunton-secure
  • mail.3mtb-securecard
  • mail.407109162710
  • mail.40864905409
  • mail.410073463817
  • mail.416261562614
  • mail.42124485
  • mail.42997469717
  • mail.44754379110
  • mail.447543791912
  • mail.44757535578
  • mail.45423402098
  • mail.45423402129
  • mail.45423402602
  • mail.45423403038
  • mail.456789871
  • mail.45687963501
  • mail.4657767616
  • mail.471099783309
  • mail.47255953911
  • mail.4758687694
  • mail.47984374
  • mail.481548248615
  • mail.484247705705
  • mail.493453457303
  • mail.4y6bcv3t3z54qmaulr6jfwkbl5gtpux8jky4
  • mail.528812331328
  • mail.53-loggin00345a
  • mail.53-portal1
  • mail.5321311230
  • mail.53435secured-78656d5r6df6f7d5d46wells877
  • mail.535475874636
  • mail.5363576545228
  • mail.53panel-helper03
  • mail.53panel-helper04
  • mail.53rd-me
  • mail.5434584596509
  • mail.546546309
  • mail.553252129
  • mail.5554347
  • mail.5554367
  • mail.5632147865502
  • mail.5634569786304
  • mail.56378993617
  • mail.5649875550
  • mail.56566576712
  • mail.56587643536728
  • mail.56974103698502
  • mail.578397129
  • mail.597861032464503
  • mail.60134747789605
  • mail.6060660601
  • mail.60627226913
  • mail.611094162701
  • mail.6252436656
  • mail.632675433
  • mail.634597799916
  • mail.6398796518
  • mail.642317619909
  • mail.652725356
  • mail.65415879411
  • mail.65422323215
  • mail.6554
  • mail.656544202
  • mail.656776415
  • mail.6635866
  • mail.673504156710
  • mail.6788865
  • mail.6788870
  • mail.6789455789608
  • mail.70010020001179921
  • mail.70124578914
  • mail.70690356
  • mail.7091806
  • mail.738171056207
  • mail.74599010514
  • mail.74645434351
  • mail.754213441235
  • mail.7625413
  • mail.7625426
  • mail.7634121158
  • mail.7776655433420
  • mail.7777766554419
  • mail.7778562566905
  • mail.78636425
  • mail.7895905
  • mail.7896554477
  • mail.789721546301
  • mail.789789211
  • mail.79854678419
  • mail.7mbmasw52ppbexhhomxd4wyyjovrag8bg2
  • mail.801111422221688600
  • mail.802534433345886605
  • mail.8025493604
  • mail.807319645904
  • mail.8110000238180
  • mail.8110000238423
  • mail.8110000238597
  • mail.8110000238786
  • mail.834873413308
  • mail.848556755217
  • mail.852365447810
  • mail.85246974575803
  • mail.8540000364778
  • mail.862464504506
  • mail.867725543301
  • mail.8764287610
  • mail.8764644941514
  • mail.876543455
  • mail.876903610
  • mail.88532532517
  • mail.88865503
  • mail.888965852648907
  • mail.88963014815
  • mail.89632154708
  • mail.89648487311503
  • mail.89654123216
  • mail.899887722
  • mail.931381356806
  • mail.9546713231
  • mail.963574012111
  • mail.9663404785911
  • mail.9678487517
  • mail.978764724579
  • mail.981231172
  • mail.9856781652319
  • mail.989876403
  • mail.9911100001
  • mail.993105
  • mail.99998574262512
  • mail.a1ask1bk
  • mail.a303dfb47951cv1
  • mail.acces-rcu
  • mail.access-mtbank88
  • mail.account-verifycation-update
  • mail.accountsupportmaildtactskfmslasx
  • mail.addrloama1
  • mail.aetmemekmamiazon
  • mail.alert-paypal02
  • mail.alertbanking-wellsfargo-update
  • mail.amazon-lckdinfo
  • mail.amazon-signin-871r0b1231-157
  • mail.amazoncom-service
  • mail.amazontigrealcom

Current DNS Records

A AAAA MX TXT NS SOA

182.210.63.101

n/a n/a n/a n/a n/a

Want useful, structured WHOIS and DNS data like this? Check out SecurityTrails

Raw Whois Results for 182.210.63.101

% [whois.apnic.net]
% Whois data copyright terms    http://www.apnic.net/db/dbcopyright.html

% Information related to '182.208.0.0 - 182.231.255.255'

% Abuse contact for '182.208.0.0 - 182.231.255.255' is '[email protected]'

inetnum:        182.208.0.0 - 182.231.255.255
netname:        Xpeed
descr:          LG POWERCOMM
country:        KR
admin-c:        IM669-AP
tech-c:         IM669-AP
status:         ALLOCATED PORTABLE
mnt-by:         MNT-KRNIC-AP
mnt-irt:        IRT-KRNIC-KR
last-modified:  2019-04-29T04:00:31Z
source:         APNIC

irt:            IRT-KRNIC-KR
address:        Jeollanam-do Naju-si Jinheung-gil
e-mail:         [email protected]
abuse-mailbox:  [email protected]
admin-c:        IM574-AP
tech-c:         IM574-AP
auth:           # Filtered
remarks:        [email protected] was validated on 2020-04-09
mnt-by:         MNT-KRNIC-AP
last-modified:  2021-06-15T06:21:49Z
source:         APNIC

person:         IP Manager
address:        Hangang-daero Yongsan-gu Seoul
country:        KR
phone:          +82-2-1-01
e-mail:         [email protected]
nic-hdl:        IM669-AP
mnt-by:         MNT-KRNIC-AP
last-modified:  2017-08-07T01:06:20Z
source:         APNIC

% Information related to '182.208.0.0 - 182.231.255.255'

inetnum:        182.208.0.0 - 182.231.255.255
netname:        Xpeed-KR
descr:          LG POWERCOMM
country:        KR
admin-c:        IA469-KR
tech-c:         IM469-KR
status:         ALLOCATED PORTABLE
mnt-by:         MNT-KRNIC-AP
mnt-irt:        IRT-KRNIC-KR
remarks:        This information has been partially mirrored by APNIC from
remarks:        KRNIC. To obtain more specific information, please use the
remarks:        KRNIC whois server at whois.kisa.or.kr.
changed:        [email protected]
source:         KRNIC

person:         IP Manager
address:        Hangang-daero Yongsan-gu Seoul
address:        32 LGUPLUS
country:        KR
phone:          +82-2-1-01
e-mail:         [email protected]
nic-hdl:        IA469-KR
mnt-by:         MNT-KRNIC-AP
changed:        [email protected]
source:         KRNIC

person:         IP Manager
address:        Hangang-daero Yongsan-gu Seoul
address:        32 LGUPLUS
country:        KR
phone:          +82-2-1-01
e-mail:         [email protected]
nic-hdl:        IM469-KR
mnt-by:         MNT-KRNIC-AP
changed:        [email protected]
source:         KRNIC

% This query was served by the APNIC Whois Service version 1.88.25 (WHOIS-US3)


This page displays the publicly-available WHOIS data for 182.210.63.101, which belongs to an unknown organization.

Recently Reported IPs: