AbuseIPDB » WHOIS 117.158.69.91

117.158.69.91 IP Address Information

ISP China Mobile Communications Corporation
Usage Type Fixed Line ISP
Hostname mhb.ddns.info
Domain Name chinamobile.com
Country πŸ‡¨πŸ‡³ China
City Zhengzhou, Henan

mhb.ddns.info

Subdomains

  • dd103.fearfix
  • eventpubgmobilecollect
  • gg-sec
  • sushitaxi
  • szakil
  • wellsverification
  • winnercccam2
  • www.idme-secureid
  • www.secureconnection07b-chase-verification
  • 01568
  • 0acisj8r
  • 3dverify-online
  • 48h361
  • 9m1w6oidn
  • aaliyah-ym1001
  • afdn10
  • agrosis
  • alone
  • bailey
  • bayat
  • beehive
  • berttu
  • bgmkewduch
  • bigworm
  • boa-verifyid
  • boeyse
  • brandy
  • brianx659
  • brody-uw1201
  • bt89taylor0a
  • cams
  • carter-cg1601
  • cenzor
  • chiasm
  • citizen873secure
  • cpg1604
  • csh
  • cubana
  • cute
  • dan82streetradio
  • dataprotectionds
  • desserts
  • diagram
  • diamondgratisdariunipin2020
  • dm38parker7q
  • donaldscottm05e
  • dver
  • eamzmaif6j
  • ej01turner7o
  • elegaxefufori
  • epicoraustin
  • essaywryrp03
  • evan-ta1401
  • fbegu3ew
  • florida-kw1303
  • fnikufluoopogatw
  • frediawan
  • ftp.cverifylog05-secure
  • ftp.dhuszka
  • ftp.laclab
  • ftp.loginfifththirdonlinebankinge
  • ftp.mario
  • ftp.swriteqyw44
  • ftp.verifyonline-bank6auth
  • gaqizxuv
  • gondolaclaude
  • gr
  • haverboardssince1998
  • helpchase
  • hps
  • hs2
  • ilsechanti
  • imore
  • incorrect
  • informatick
  • ix57scott0o
  • josenobertoo
  • jptrs23
  • julias
  • jwk0107
  • kohl
  • limlkdyvay
  • lorecon
  • luis-qq3112
  • lukaszkv
  • lvbags
  • mhbwkhqwyw
  • milunanochesc
  • mjb0e1
  • multiworld
  • nhl
  • niedo1us
  • noenutcie
  • nolimit
  • oe39martin0a
  • oklahoma-bs1201
  • ou65lee8t
  • oversized
  • owooqcetrcv
  • paola-gm1201
  • pcewpeixds
  • pentadisf
  • qacomr
  • qx43allen6i
  • racines
  • railto
  • refadweyu
  • rg461bs
  • rogroo0406
  • rotana
  • rt39martin9r
  • rumat
  • s7ifycur65dk
  • sardiospirsi
  • sbneto
  • secureip003logins
  • semsphop
  • shjvc
  • simonguenneguez
  • siphe2706
  • sjaxu1id
  • sparker
  • stcu-a
  • swritesqm28
  • taichung
  • thalhammer
  • tiores1006
  • tmsge
  • trident
  • tz06turner6m
  • ub72hill1c
  • usfcs
  • usvi
  • verify-del-one-fcu-user003
  • vg18.acc
  • villagio
  • vsadmin
  • vz66evans1y
  • wan1.pengsl
  • webmin.uzdronet
  • westwind
  • wgulmxhlmwsql
  • wing2
  • writeesscen65
  • writeessrqg60
  • www.031te3
  • www.3v2uo0
  • www.admin-01secureinfo
  • www.alyazidy2016
  • www.authcitizens3
  • www.authenticate-ecu
  • www.authenticatectzn
  • www.battle
  • www.bounty
  • www.bumfwtirck
  • www.cpger
  • www.dalmintretna
  • www.famillegeorgi
  • www.gunungshari
  • www.hsk111
  • www.iqipo9on
  • www.izxglrwj
  • www.odoo
  • www.paulmillerp02k
  • www.protect03didentity
  • www.pubgspinm416
  • www.rec-midd-hosting01274892365a
  • www.rw81lee5v
  • www.rzh1bo
  • www.secure-server23hf
  • www.sgpqnx
  • www.test.nassere
  • www.tomin
  • www.trustme
  • www.userservice
  • www.vr-11871
  • www.writeessfsw05
  • www.yezuyc
  • wz92moore2y
  • xm82wilson5f
  • yimevuas
  • ymuooaeq
  • zehanli
  • frek890
  • 5v8a3oigx
  • agroleon
  • americanfirstreview
  • au-gov
  • aybspnet
  • babuonline
  • badass
  • cetisoftware
  • darkice
  • doek
  • ecu-online-supp01
  • elianakza
  • fotomobile
  • free-bundle24
  • ftp.careassist09i-infoauthorize
  • ftp.dcu-weblogin
  • ftp.ncsecu-org-mobile-login
  • gagan
  • hawo
  • highot-2.dynamicvpn
  • integration
  • mail.arboles
  • mail.freeuc-10.00
  • mobilshouse1
  • naisimarodow
  • neysortsmel
  • patricknas
  • poool
  • qatar
  • qzoypoabhxrauijo
  • rf8u.w3ik
  • rowthkarrela
  • sarah-pu1201
  • sofia-lz1101
  • stg
  • ticamrahu
  • tincho
  • www.24secureacc
  • www.conecty
  • www.fdmserver
  • www.freckles
  • www.iccu-com-click
  • www.plajuk24
  • www.server
  • www.user-americafirstlogin
  • zauthumb2508
  • zph
  • www.mohsinternational
  • zobaim
  • eventluckyspinfreefire
  • jb82
  • ksklwpcyvyr
  • mysimplyw
  • news.navy
  • secure2-dashboard
  • www.del-one-supportuser02
  • www.luky-spinffgratis2020
  • 10p18z
  • 3nhb1
  • abigail-hr1101
  • aggaa
  • arik
  • aviator
  • brewster
  • cazzv
  • cemaco
  • da72220101
  • dam
  • datingpolen
  • deboutique
  • dunchan
  • ecu-supthelp1
  • ejbtkbmunpe
  • eupnrmniio
  • fivaxy
  • flipper
  • ftp.armado
  • hacloud
  • hawaii-fb0901
  • hrvpn
  • ilaasoa
  • janicek
  • jhxxyhpdtg
  • kiosgudang
  • lasxremn
  • leyreijorso
  • lzoxnzkkft
  • m09r2x3
  • maryland
  • oazicxeed
  • okdsew
  • openvpn-moscow
  • oracleyyn02.dycwuxing
  • parf
  • return0041
  • reynolds
  • ronsoft
  • spina
  • stachboame
  • swritezbm36
  • szizugmuricutexn
  • tecnosh
  • transparencia.pmtr
  • ttp2b
  • tvmk
  • vpgiurngvkgs
  • www.cidisabledauthsec3uree
  • www.manage-uspostals01
  • www.mods
  • www.mvabrothers
  • www.omevraham
  • www.pubgeventnew
  • www.sesbellforly
  • www.verify2account1
  • www.vremenska-prognoza
  • xiongbing
  • xiuno5in
  • carcass
  • deligh1108
  • eowuc
  • epping
  • fitter
  • ftp.tanjungduren
  • hedtempnrvz
  • lebeau
  • nsxsc
  • periscope
  • preparedness
  • prstenysnubni
  • suretneycter1005
  • tayix
  • vexenepm
  • writeesspdr16
  • www.audiostore
  • www.eventfreefire
  • www.steck
  • zrihmt
  • aio
  • alabama-wv0801
  • algamet
  • amiinatour
  • artifactory.developer
  • authdel-one
  • bettasayyes
  • blkl
  • bofa2q7ucq
  • branch650024.fairstone
  • cgm
  • christian-ar0901
  • dbm
  • devos
  • dezonyes
  • dfnrzlqfnul
  • diaglenseana
  • dido
  • dx40wright0d
  • elizabeth-kq1101
  • emeraudecondomin1
  • erim
  • essaywrfaw88
  • fnru52o
  • ftp.bilans
  • ftp.dkb-kundenportal
  • ftp.ncsecu-org-onlinehelp
  • ftp.secure-server33
  • ftp.smotri-vuuteh
  • ftp.veifywellsfargo
  • gabriel-fb1301
  • gisler
  • gitlab.developer
  • giusti
  • groton
  • gujherwaqa
  • hafoki
  • herisson
  • heyoyyum
  • horizon
  • info2accessweb
  • irs-stimulus-gov
  • j4v3rvbbw
  • jackson010212xo
  • jfv
  • jfzrscqmio
  • jiajki8osaksda
  • k6pp3
  • kennethallenf85z
  • klinsmann750
  • legend
  • loco
  • lokal-direct
  • loxufuaoet
  • ma41brown6l
  • mabotitog
  • madog
  • mcjujgspzw
  • medium
  • michaelsmithc56e
  • michigan-ip1301
  • mikewarner
  • n9ygrkvrzx
  • nataly
  • on
  • podoro
  • poms7
  • prabumulih
  • puscsagtote0905
  • rb52086
  • riguraketo
  • ryya
  • s83on
  • saabreathgize
  • sadik
  • secure4-account
  • siotoupephee
  • smkn1sekayu
  • smotri-vuuteh
  • sofia-hy1501
  • sverreskeggi
  • tarlvendemo
  • thepigfarm
  • tjnldijqhgiakup
  • turbonet
  • uhy0602
  • utah-uh0801
  • vantagewestdigitalaccess
  • verbea0306
  • wallet
  • wobafqax
  • wpweoegtju
  • writeessxjh34
  • writeessyos61
  • www.1nfo-s3cure
  • www.adriana
  • www.certify-ecu1
  • www.china
  • www.cibyhesyx
  • www.e3leb
  • www.handyman
  • www.htasi9uy
  • www.i2
  • www.jfjzc0k
  • www.kesa
  • www.martinb
  • www.nevahe7mu
  • www.nftlx09-surce
  • www.postepay-securelogin-bancoposta-access-valid
  • www.secu5relogin-c3itiaccess
  • www.swritebre91
  • www.uspostsbox-track
  • www.verifyecu3
  • xai
  • ypufyozowm
  • zlzilapdwd
  • zvuceblyuw
  • mingo
  • tdmpinturas
  • gppefpkhpzkqu
  • hawaii-rq1101
  • kezaziz
  • cee
  • focus.milk
  • ggl
  • www.games
  • www.jmbjjs
  • defex
  • kecazanhu
  • linkupnet4
  • masite
  • noelson
  • reb2203
  • vg34.acc
  • victor2002
  • www.91jz2b
  • www.event-item-garena
  • www.glasskote
  • www.mta
  • 10035
  • 25tkd26
  • 68u562
  • 6gzi.w3ik
  • a2z
  • absolutions
  • afysx
  • anitallat
  • anthonygonzalezf46c
  • arpa
  • bittlinggeschsan
  • blognancy155
  • bmgdiwbxquox
  • branch670029.fairstone
  • brightguidevr
  • bvnqsndafewlgjeie
  • camera01
  • careforcows
  • carvalho
  • chloe-pw3112
  • chodzsalrore
  • chse01authenticverif
  • compubyte
  • conf.alaj
  • cosi
  • cvzfdouivj
  • dan13
  • darry
  • dataserv
  • dejutevhor
  • dh74allen0u
  • dingzengxi
  • diq
  • djki
  • dsm.teddy74
  • dtw
  • dungs
  • ehiktokyc
  • elsmann
  • eroshaver
  • esmann
  • essaywrbhl56
  • essaywrkck63
  • essaywrxcr97
  • ev21wilson0o
  • event-item-garena
  • family
  • fast443ip3
  • fhcjf
  • fifth-thirdrecovery
  • fomuxmapl
  • forzagitalia
  • fruitloop
  • ftp.amplepwr
  • ftp.citizenbankaccountrecovery
  • ftp.fr10white5c
  • ftp.ickoipfizzxlxpw
  • ftp.knight
  • ftp.manduria
  • ftp.mobilelegendskin
  • ftp.mx-srv-60
  • ftp.pijjekmdun
  • ftp.sec-icheck-39es
  • ftp.secure00-connects
  • ftp.square
  • gam38090801
  • gf34parker5c
  • glpstamapf
  • gomby
  • grasesabap
  • ht14lewis8h
  • ics
  • imarol
  • ind7
  • ishopping
  • jacob-sv1001
  • jargon
  • jon
  • kbm1
  • kluska
  • kolmar
  • kost
  • kostr
  • ksamk
  • lexus
  • liners
  • linikunsder.fenikos
  • luodj
  • lustginkteto
  • lyefu2im
  • madison-wf1001
  • mail.joinblos.00
  • manassas
  • mark0
  • mc.meintest
  • mcjm
  • mdp
  • mehdi
  • mesaages-gunge
  • money
  • moreton
  • murihiew
  • museums
  • mw
  • nb3xl1kh
  • nikolas
  • ola
  • oliju
  • opulentblissful72
  • ovolalpkrp
  • pegasushomeopathics
  • perli2308
  • ph2
  • phxgrqadge
  • plefebvre28
  • polar
  • pound
  • pqyihk29
  • propac
  • py28adams6s
  • qibiunzawapolei
  • qvc1841
  • radical
  • ralo
  • redfenix
  • reed
  • release
  • ricardoamaral
  • ridley
  • rjauxn
  • romano01
  • rvnnxfvueha
  • secure-verify-account
  • secure03-verify5
  • securelogin-myposte-jod-fcc-id0019
  • sides
  • slides.lviv
  • spexiogeholelapx
  • stero
  • support02-ecu
  • swimming
  • swritebum64
  • szilviacsemege
  • trust
  • vantagewsupport
  • vc88davis0x
  • verify-del-onefcu-user1l
  • vild
  • vir.luodi
  • wangxiaoyu
  • warning-citi
  • webdisk.kbit-host.00
  • william-ot1301
  • wkaiqcp
  • wkas
  • wpvqtyuoim
  • writeessata16
  • ws39baker1b
  • www.4nh533
  • www.a01112077428
  • www.account-info07-vetify
  • www.bd
  • www.dokewuzudeu
  • www.ecusupport2
  • www.jamescarters36x
  • www.jyakymuvxv
  • www.maibracmojo
  • www.matt
  • www.pubgspin
  • www.secure-07-account
  • www.sq5b8lixm
  • www.ssp
  • www.vehud-utube2020
  • www.verification-chase028b-securityhost
  • www.wbj
  • www.writeessvyn84
  • www.yundns
  • xpqos26
  • yezuyc
  • ygljl
  • ylmy
  • yzj
  • znqypfldz
  • zone-62
  • zxyprvhro
  • geodiscovery
  • garanhunsgc
  • guac.townyfunhouse
  • lalalalalaakakakak
  • nets-dash
  • slutbunwallah
  • cavok
  • kolf
  • 24accdocsub
  • 3i1n5g4v3i
  • beanstalk
  • berg-gebaeudedienste
  • brianna-ye1001
  • buysellpoint
  • cbpi
  • cv77mitchell9u
  • ftp.7untington-supp0r7
  • ftp.dan265streetradio
  • ftp.event01-freefire
  • fuxfaq
  • gadelha
  • grind
  • grwlovas
  • hahn
  • hrmyij
  • iap
  • jasonnelsonx79t
  • jelratopta
  • k24ayanikupang
  • kevinn
  • khankondada
  • lake
  • lillian-tq0801
  • lnbqsekjakyg
  • medicalexport
  • membersvc-ecu
  • mensdutote
  • myposte-aggiornamento-anagrafica-obbl
  • rpoevcplzp
  • saks
  • securewells-fargo
  • stifler
  • supplies
  • ta68jackson2t
  • teletubbies
  • verify-account-info
  • verify1loginyt
  • writeesscer69
  • wsecureafcu
  • www.aurora
  • www.cams
  • www.hotgirlsplay
  • www.jaxesayuguah
  • www.mtbank-lockedww3
  • www.secure28-connects
  • www.verify-van1
  • xn28turner2m
  • xutevas
  • yt72baker0f
  • ftp.smtp365-cloud
  • lidezhong
  • mail.beasts
  • msdmrrrjmynelth
  • presilkathe
  • puerto050112na
  • swritedqk59
  • thor
  • vg05.acc
  • 102fm
  • 1896
  • 3455
  • 3qnwad8fvbw
  • 4075
  • 66sec3ure
  • 7b2e2j
  • aamvcaa
  • aj
  • alabama-tr1101
  • allemanno
  • angusnoach
  • anp
  • apan0106
  • autubzex
  • ava-hc1003
  • axepta
  • bcpe
  • benefits
  • biamed-wettringen
  • biria
  • boris
  • bracelets
  • bread
  • bricole
  • c1.hiperc
  • c9.potay
  • c95081
  • calculatoare
  • caleb-ye0901
  • canh
  • ciatechpostli
  • cicakdidinding
  • cvahedc
  • daniel-zw1001
  • danielli
  • devisolation
  • divendres
  • donaldthompsons94d
  • drandre
  • drifer
  • ej16nelson1b
  • ella-jf0901
  • erka
  • f.shaftsvote
  • failurr
  • falrytodiv
  • flesz
  • freeswitch
  • ftp.bhojsyntamar
  • ftp.cherub2020
  • ftp.cvahedc
  • ftp.dan26streetradio
  • ftp.khanhvip12
  • ftp.rjudeva
  • ftp.server-secure45n
  • ftp.stefanini
  • ftp.tlthamradio
  • ftp.verifya53-severcc
  • ftp.xizicoqg
  • furry
  • fvjohwoyau
  • gateway365-gate
  • gmail-account-management-center
  • gpl
  • grays
  • guviwuzuratokav
  • hj15491.hkr
  • hkdjhrfhzy
  • hqddzxsosj
  • hunts
  • hvubu8ih
  • hydra
  • irrenhaus5
  • johnphillipsc40e
  • joplin.tramnhien
  • juan060412dl
  • kansas-rt1101
  • kingdrivfifeed
  • koala
  • laemily
  • lead
  • leah-ig0403
  • lies
  • linuxfans
  • lupzgdj
  • luruplinux
  • mail.amigo
  • mail.sesion
  • marus
  • mbgjihukdonyrcn
  • membersuptdelone
  • meyvilaszne
  • morris
  • muk82091101
  • muzera
  • mv17hall2g
  • myles
  • na-di1301
  • naa.soro
  • nova
  • olivia-di1001
  • onamanguana
  • onlinepayment-platform
  • onlinepoiuyhuy
  • otgzcfq
  • pavax
  • pgxmydzuoj
  • placeiberville
  • pol01d454qaz
  • primiz0306
  • psgas
  • psych
  • puerto-mz1101
  • rb17lee6t
  • robertopraia
  • robin
  • s9lecotrams
  • saadaniparkblog
  • shasta
  • six
  • sold
  • soundtrack
  • stnv
  • supportcntr-ecu
  • swritecps95
  • swritewrs19
  • swriteyws95
  • teddy
  • terbredfina
  • tfiywxmqfcm
  • tizitlah
  • tredcazy
  • two.tv
  • user-citizens
  • valeria-xi1101
  • vandy
  • vehicle
  • wangke
  • wocafa
  • www.cfrxrgvbbd
  • www.eterra
  • www.f3qqfb
  • www.foo
  • www.gibonufeveu
  • www.isenberg
  • www.michaeljonesi02l
  • www.pk66wright8b
  • www.portcizuti
  • www.rbfcu-mobile
  • www.server-secure45n
  • www.supraserver
  • www.swf
  • www.teacherscuc
  • www.verify-secured07acc
  • www.verify-vant
  • xbwriekzn
  • xoxmaman
  • ypsus
  • zl47baker2i
  • 4902
  • www.vg5dxut
  • swritewxk79
  • metalnas
  • sat8s8star
  • trevoestacionamento2
  • unifi.seanbunce
  • www.account-recovery
  • www.apipolygcl
  • nickcuaphuc
  • 7q79e88qoyf
  • appliancesz
  • bhwxrlb
  • eetiyoqaxukyolce
  • ftp.jeezaxyne
  • gu25young0p
  • im0ml9tk
  • infoverify-account
  • judaco
  • neulo6os
  • penang
  • scipy.potay
  • score
  • verify-security
  • vire
  • www.pnc-accounts
  • www.ufwwe
  • zxiodlopeloo
  • 0q5jl60zu6w3
  • 174do
  • 4242
  • 5fujozou
  • 8364
  • 8kqyjrin9wk
  • aahqxeinjj
  • abriatover
  • adrefenza
  • aigujxak
  • air
  • ajhu
  • alaska-rz0101
  • alba
  • anna
  • aom98151201
  • arizona-gr1301
  • bapi
  • barbara2
  • bauiq
  • bbcas
  • bcs
  • becbiyzypmqzv
  • beojzi
  • bkktetra
  • bobsonfinanc
  • boxdiamond
  • bpnaleay
  • brazen
  • bsba
  • byzantium
  • caffenero
  • california-ew1301
  • calri84made
  • cesnighprotet
  • chado
  • champ
  • ciaprovinva
  • citizens-secure-access
  • citizensauthverify
  • clj
  • comdihanva
  • compliment
  • cyvexjfkma
  • d9ja.gc7c
  • david-yl0801
  • demo
  • depth
  • drugs
  • electricity
  • ella
  • email-yahooupdate
  • esoft
  • essaywraex39
  • ewvb20
  • ezonelaksa
  • fallon
  • files79301
  • fleischmann
  • ftp.cafe
  • ftp.f4154e
  • ftp.garam
  • ftp.josenobertoo
  • ftp.midwest
  • ftp.secure2abportaladmin
  • ftp.xb09evans5n
  • gabriela-xv1401
  • ggocaizaqimudang
  • gimavimof
  • hkt00.tabout
  • hmue81qciupc
  • hmunoz
  • hnkqgnwqlrfe8zq
  • hold
  • https
  • idijljnursb
  • imladris
  • info-security-update
  • inrianetthe
  • itemff-free
  • j643hbe
  • jaliaefacoquetjw
  • james-dx0603
  • jbjzpbxsor
  • jcdo
  • joseph-aj0801
  • jzpriv1
  • kansas-cv1501
  • kavneet
  • kiama
  • king6
  • kirs
  • kmac
  • kohejiccaj
  • krrazio
  • levee
  • light
  • liverpool
  • ljigronst
  • louisiana-sk1401
  • ls33thompson9p
  • ltb
  • lucy-yi1301
  • m5ix.w3ik
  • mail.oscuro
  • majestic
  • marbleandgranitecolumbusoh
  • may91131001
  • medo2
  • memo
  • mgeclamxc
  • mta-delivery
  • mygirls
  • nassif
  • ncbzh22
  • ncsecu-org-bankhelp
  • ncsecu-reactivates
  • nf27king3t
  • nizam
  • nox
  • oekofen
  • oklahoma-nw1501
  • ortycom
  • oscar28
  • ov15yeeint
  • ovuue4fstqb1ay
  • ozo
  • p3whkufmlf
  • paulconstans
  • pega
  • pingtung
  • pobennev
  • poster
  • postmaster-service
  • pt0u9h
  • puerto-xe0101
  • pusufoq
  • q
  • qmore
  • racine
  • rancher
  • recstream
  • redhot
  • rewopen
  • riands
  • ritter
  • rsareen
  • rubicon
  • ruskin
  • samantha-vv1401
  • sarah-ld0801
  • scxh0802
  • sent
  • shutup
  • smec
  • smp5
  • souvenirsofia
  • srvj10
  • srvrm
  • sslxsuib
  • support9-vantagecu
  • swriteiph81
  • swritezlo15
  • sybase
  • sypeliuvaih
  • tansi
  • tc84adams1c
  • te
  • thumbsup11
  • tmt2
  • tracanli
  • tricky
  • tusdh
  • tutoring
  • tx18hernandez9p
  • tyler-er1301
  • ueetbc47qko5nmgfwgcv0twiwpdrmac
  • uros
  • us-nimble.gcwmi
  • uvlo2702
  • valdisere
  • valeria-pt1501
  • verify-ecu-member5i
  • verify2account29
  • victorias
  • viohosecon1005
  • vuzuobd
  • vw26wilson1n
  • webi7
  • wirwdzgu
  • writeessvdo39
  • writeesszpg29
  • writeesszyf13
  • www.102837210389723009
  • www.api-mid-transferhosting
  • www.barotraumahispano
  • www.buluj6l0eebh
  • www.bwvolunteer
  • www.citionlineverify
  • www.citizens-verify-policy1
  • www.cityrecoverylogins
  • www.dan
  • www.eugumenlir
  • www.fargo81-secure
  • www.mlsshggzrvuux
  • www.navyfederal-onlinesecurity
  • www.ncsecu-org-mobiles
  • www.neautomacao
  • www.neobo5og
  • www.pontox
  • www.rengasbandung
  • www.sip
  • www.suslik
  • www.vuticimayiux
  • www.wimax
  • www.zelazny
  • www.zgmxwsnzxhd
  • ya69mitchell0f
  • yadindrvja
  • yigohaw
  • yoyodakeru.nesplu
  • yqetqgdkdv
  • yummy
  • yuynessybq
  • zganlrwd
  • zh
  • biggest
  • awapp
  • identify-rectify
  • restorecltl
  • s-service
  • ulepsa-pasco
  • verify38-connectus
  • verifysecures-bank
  • vvm
  • www.mobilelegends-yzd
  • 230oasfurs
  • 23w7ase4
  • 3v85k80p
  • 75qjb78
  • 95ezrv83
  • alopefro
  • amanda-pz0801
  • amclonaptrav
  • antoniosantana
  • app.emporioalfenas
  • arisara63021001
  • aubrey-op1401
  • b6-2.b-hotels
  • barroque
  • bazaar
  • beautyline
  • ber
  • bilverdy
  • birley
  • clouds
  • cottony
  • cpl
  • cpsevacuate
  • cu33miller1o
  • cyberflash
  • dcu-access
  • dcu-contacts
  • despierta
  • dopes
  • dorothyyqh
  • ella140112on
  • ellis
  • essaywrlup57
  • eyal
  • filial06
  • fmv
  • ftp.jqfp1
  • ftp.lucky-spinfreefiregratis2020
  • ftp.reciclados
  • ftp.viniciuslompa85
  • ftp.wa-sex
  • ftp.wingowong
  • ftp.y1m2ort
  • g183pf2
  • garovd
  • garth
  • gavin-za1101
  • georgelopezt06a
  • hhyks25
  • hingotomoro.novot
  • homesecurity
  • hriwamiyepefocemisobaeyw
  • hulk
  • husxv
  • idolclub
  • idorunip1105
  • illinois-zq1001
  • j1oi13e
  • jacear
  • james-av1301
  • jessicasimsonshoes
  • katherine-bb1401
  • kents
  • kt7el5mz
  • lc83hill2o
  • leanote
  • lenovo
  • litzqnhiioxu
  • login
  • lordpercy
  • marterblogs
  • mazdaphahol
  • medusa
  • mi23green2m
  • misperflitab
  • mixnet
  • music
  • mysymptoms
  • nadeem
  • namai
  • nc20young2z
  • netto
  • nfcs-reform
  • nfsesantaines
  • nicole-se0801
  • onpoint
  • orlando
  • ou64harris3v
  • ouszacuutjck
  • poter
  • puerto-qs1301
  • pzmeoskeqmy
  • qwsdwl09
  • remoon
  • rieha1406
  • sauitalian
  • secure-server23b
  • secure-server23verify
  • secure09b
  • sideral
  • siteangywhol.gdut
  • smarthus
  • solr
  • sparta
  • specod35
  • storicfecci
  • swritebre91
  • swriteggw83
  • sytrt
  • tguxoswomacouakc
  • tisch
  • turttinsmiza
  • twister32
  • tyler-gx2003
  • umbrella
  • update-verify-account
  • varanda
  • victoria-ns3112
  • vmympxbo
  • vpnqspr
  • w3
  • waterfall
  • whatsappskh2wje76ahja
  • william-vk1201
  • wjgrkqshfq
  • wm3uri1qnx
  • woolers
  • writeessmqs43
  • writeesstlt59
  • www.adezlslocwr2wkk
  • www.alwkxetwwfhpd
  • www.app-auth251
  • www.c-i-t-i03ac0untverify
  • www.ch75e-5ecu4e
  • www.del
  • www.euytkfwa
  • www.exercise
  • www.fahmi2021
  • www.fyq3720
  • www.godzilla
  • www.magnus
  • www.moroz1
  • www.olkidbret
  • www.rbfcuonlineaccess
  • www.secure03a
  • www.signin03d-infoaccessauthorize
  • www.surveimobilelegends
  • www.terhajno
  • www.tika
  • www.trduy
  • www.ttl
  • www.uni0nnetappserv
  • www.verify-del-onefcu-user1l
  • www.verifycase07-secure
  • www.verifystart03-secured
  • www.web0-1secure
  • www.xmnfytmsup
  • www.xp94edwards5j
  • www.zejitxac
  • www.zesohaqk
  • xdaepsokaxou
  • y045
  • yzvvqgqnap
  • zjjh252.hkr
  • zzdibwalwd
  • able
  • adfdfhr
  • adriana-bs2912
  • bionl
  • blunerwover
  • deming
  • eficg
  • famamjeuj
  • feyliacrit
  • ftp.caprunio
  • hailey-cx1101
  • laumu1108
  • marilyn
  • myspiresettingsv2
  • nudovufisojoyew
  • pacul
  • professionals
  • ryan-rr1401
  • swriteuxq80
  • timwide
  • virtualink
  • www.buror1306
  • www.i6obyu1i
  • www.mail365-out
  • www.minhnguyenshop
  • www.mypostepay-verifiche-online-titolari
  • www.najd2016
  • www.neohpgnliu
  • www.pihmiygmyy
  • www.verify-account100
  • www.visitenkarten
  • 0oh1oe8w
  • casanet
  • cerbero
  • christian-ik1001
  • christopher-ic3012
  • datamium
  • dk35baker0c
  • ftp.meintest
  • ftp.raoul
  • getfairossni1005
  • hduhxlsbfw
  • illinois-tf1101
  • kentandkelly
  • mail.dibujada
  • qcmdkeugjpqid
  • rel.soro
  • swriteopd37
  • uciku6ab
  • www.cf139
  • www.secureaccount-amazonsitepage1
  • www.tilocbjueb
  • zolekauy
  • foton
  • del-one-help01
  • www.secure03citiweb
  • nxwx
  • citi-verify007
  • fashionable
  • ftp.agh
  • jfcasteicao
  • mail.sec02verify
  • socinal
  • ukraindh
  • verify7ddns-secure
  • wp.luuviethai
  • www.labanquepostale
  • www.linz-server
  • 0dlzanhs
  • 1o1m891zg
  • 4050
  • 91403
  • a26.gm-a
  • agrosp
  • alexander-wx1301
  • arcovan
  • asixutw
  • ayqatc
  • bhbcyxwggdbo3ve
  • bird
  • blggsuf
  • blmbfpeqx
  • bondi
  • branch690012.fairstone
  • buirecteci
  • california-qs0901
  • calpe
  • carbonnet
  • chloe-dk1401
  • citizenzens-bankhelp
  • classifieds
  • cocze
  • conti
  • conviva
  • corax
  • doyukahn
  • dudu
  • e88
  • ecsjjggloa
  • ema
  • ennainode
  • essenza
  • etymology
  • faggot
  • ffaaii
  • folrihidmoonsde
  • ftp.lothar
  • ftp.napthengay
  • ftp.newguidexx
  • ftp.postepay-myposte-id-aggiornamento-010248
  • ftp.schumannsystem
  • ftp.secur05info
  • ftp.sylvain
  • ftp.update-afcucontact
  • ftp.verify-vantage-westcu06
  • ftp.wellsf4rgoacc0unt
  • fudcom
  • georgephillipsx8o9
  • gm-w
  • groby
  • hfmuvs
  • hiper
  • hitachi
  • hyjuki
  • iauejsfln
  • ict
  • ilovelulu23
  • imrueteli19
  • inreverse
  • inualulbel
  • jbuwi4oq
  • jfmk6
  • jh81edwards5u
  • jonathan
  • jtora3ew
  • klampok
  • kmod
  • kqupupvutipewihg
  • mail.mitnehmen
  • mail.war
  • maya-bq3012
  • mono
  • mq94
  • myphototribute
  • mytopad3
  • nicholas-ad1001
  • nnwywdpqfj
  • node3
  • ntotrizogbtxewh
  • oafs
  • odfhfa
  • ospvxsk
  • phrase
  • pnauozciqsez
  • princeton
  • qlptopcrbbv
  • questions
  • quinteros
  • rafael
  • rahal
  • raithromnamo
  • rejuva
  • return00453
  • richardhernandezs30x
  • robertrobinsonf27z
  • rudi
  • ruskiii-balie
  • samco
  • serviceg2
  • shenzhen
  • shxs
  • side
  • sj40lopez0h
  • stc
  • suslik
  • swritegrx23
  • swritenhe13
  • swritetse48
  • swriteyyo84
  • tattoo
  • taylor-nj2602
  • tirana
  • tkvomijpao
  • tutx
  • twenty
  • ubemk
  • umhelmsdale
  • v762
  • vxhtzpi
  • watsap
  • writeessqie53
  • www.auth-infoo
  • www.authdel-one
  • www.blanc
  • www.cv77mitchell9u
  • www.dan27
  • www.enmayrumbnetp
  • www.grupwhattsap-join71
  • www.havd
  • www.mta-dispatch
  • www.netmaster2
  • www.postepay-online-verifica-dei-dati-necessaria
  • www.pradtelecom
  • www.sauroakcpea
  • www.secure04bchase-onlinesecurity
  • www.sntmfwpbxd
  • www.talaganis
  • www.uezebuiz
  • www.verifyb5auth-secure
  • www.w789
  • yades
  • yl
  • zyd
  • 1na
  • 81g60
  • 90007
  • ace1403
  • acer
  • adventist
  • alanis-qf1001
  • alexander-lj1301
  • antis
  • ar15jackson5x
  • behstromovka
  • birch
  • branch650030.fairstone
  • brossi
  • carpeta-ciudadana-servicios-espana
  • chappies
  • concepcion
  • cooking
  • cpcontacts.user0verify
  • dajodogameu
  • econom-apteka
  • elder11o
  • essaywrpvf18
  • exe-view
  • fenbzzhio
  • ftp.flexcloud
  • ftp.fsbdds
  • ftp.oa67garcia2f
  • ftp.secured07
  • gabriella020212qd
  • i5olbi6g8ed
  • iillustrator
  • isaiah-yh1101
  • joes
  • kakapd
  • kansas001
  • laki
  • lirel
  • mantfred
  • massachusetts-bs1501
  • maxlan
  • montana-mu1401
  • mui
  • nail
  • north-zt2202
  • obi
  • onlohydta
  • pich
  • pimpon
  • qafexaka
  • rellum
  • reseo
  • ruzinov
  • savermano
  • serepan
  • siemens.spss.xyz
  • stamargarida
  • swritextq48
  • trike
  • vintalyclub
  • wnvxjekkqvwjxd
  • www.7146v
  • www.accgame
  • www.birmenstorf
  • www.ms1
  • www.ysw
  • xijp1703
  • yanisa39121612
  • zorropmk
  • 06326
  • citizens-verificatiion
  • ftp.ncsecu-reactivate-access
  • ifiles
  • pyload.mathieu-jodar
  • secureconnection17b-chase-verify
  • video.tszho1214
  • wyle
  • 13
  • 1700
  • 19446
  • 33130
  • 4427
  • 80205
  • ajbtpvhtjztmd
  • algor
  • ashley-ow1301
  • atavism
  • audit
  • aws.luodi
  • babice
  • babystoreoo
  • balou
  • beige
  • bicaservices
  • blackdragonx21
  • braintree
  • c0nfirmauthinf0s
  • cable
  • california-gb1802
  • cckno1
  • centecseguranca
  • charlesadamsh25m
  • citlzen-04secuie
  • comics
  • convention
  • cordpanchtownda
  • cw22carter3w
  • dan183streetradio
  • darksys
  • delnetpe01
  • dfaso7ex
  • dhcpdomain
  • dhfastonhfslf
  • dlhome
  • dobri
  • doenasona
  • dragonfly
  • e3
  • emagazine
  • enable
  • essaywrhbx44
  • essaywrjpn54
  • essaywrlpj65
  • essaywrtov34
  • evelyn-gz2002
  • fiber
  • filial38
  • florida-bk1001
  • florida-jz1401
  • ftp.georgewalkerx45i
  • ftp.netflixmobile
  • ftp.si68nelson3e
  • geils
  • gf3g65
  • gigahertz
  • gixurjquwoa
  • gnebe0ul
  • gvure5ef
  • hapet
  • herbert
  • homeassistant.nsnetwork
  • hotuneohix
  • i4u1d6l7
  • ifb
  • ireland
  • itr
  • ivpiter
  • jayden-kx2701
  • jefaisducafe
  • jerez
  • jnec201
  • joan
  • jomunixw
  • josiah-zj1201
  • k24sipin
  • k2p
  • kh
  • kothewolneres
  • ktv
  • kumaran
  • lahouilleblanche
  • lasoty
  • leighton
  • lf34williams3x
  • localnetworkssuzano
  • lucas-wj1001
  • mak2z91m3y
  • maryland-uj1401
  • mindha
  • minkoff
  • miuedes
  • mkaps
  • mklp
  • molly
  • moviesonwalts
  • n05.gm-n
  • namzwuugc
  • nfcu-bankingonline
  • nw53nelson8t
  • obi1
  • p27d532ofp
  • paola-il2806
  • peterch
  • pitas
  • pls
  • postepay-posteitaliane-verifica-id02277
  • pvt
  • qsome8ef
  • r7sd.gc7c
  • ransynchkyte
  • rex
  • rubio
  • s0um669
  • sanders
  • sayam
  • sebastian010412mu
  • secure-boa01
  • sheam
  • skins
  • smarpjjibc
  • spartak
  • spring
  • studiocristalis
  • suerte
  • supreme2020
  • swritekdk87
  • swriteuda40
  • swuhuh
  • szcy
  • tbego1oy
  • tcgwgermv
  • texas-ks0703
  • thorserwis
  • trmbyxekaumtx
  • ultra-ussi
  • undead
  • uriuri
  • vanacent29
  • vernon
  • vg39green1t
  • vireapoumo
  • vmfnoc
  • vnbkyd
  • vpnphb
  • vr-87709
  • waiwangcc
  • wcztmjyh
  • wheeroramo
  • wight
  • wobbbubbta
  • writeessgtc88
  • writeessuul33
  • wsslgz
  • wtc
  • www.0nlinechaseldverification
  • www.bm26hernandez5b
  • www.butternaly
  • www.ccz
  • www.cpoke1r4h8
  • www.customer
  • www.fhhtpyfeak
  • www.filial17
  • www.fnujpo
  • www.forex
  • www.gemsgratiscoc.00
  • www.getclaim
  • www.huzakziy
  • www.lewis7
  • www.livio
  • www.liwomia-mult
  • www.marterblogs
  • www.preguidemr
  • www.putihome
  • www.rabo-redirect1
  • www.richardhernandezs30x
  • www.school-first-cu
  • www.secure-account-53bank
  • www.services-aolmembersys
  • www.srpfcu-member-policy1
  • www.stcu-s
  • www.verifirsthorizon
  • www.yzvvqgqnap
  • www.zampa
  • yukai
  • yzpcdfbgzrfpk
  • zq37parker4n
  • cadal2
  • farfar
  • ftp.hyjuki
  • ftp.villeneuve
  • mavam
  • mia-yk1401
  • mikrotik2
  • pagopoieio
  • paso
  • posz9
  • ruburiwunaoxkaoddoefp
  • verify-53authanetc
  • videoclip-slidesharew
  • www.cinque
  • www.mes
  • www.ncsecu-org-decline
  • www.wjoseph0tg
  • www.vantagewest-care04
  • gioffredo
  • ncsecu-mobileapps
  • online-verify02authb
  • playabara
  • www.ricky2000
  • ftp.enc-uhd
  • 043334c
  • 10lbs
  • 11mm-hatchet
  • 1701
  • 1936
  • 1goacrewdifmo.kosar
  • 79mhxiab95rk
  • 96fj5
  • a-e
  • aaxuvet
  • action
  • aer0103
  • african
  • ak35nelson6r
  • alexis-av1301
  • alysea
  • alyssa-tn1301
  • anya
  • arizona-ih1201
  • arjgkgiumiakldp
  • asacrestie
  • auzana
  • bav-gw-drujba
  • benoitjoseph
  • bethany
  • bevin
  • biologist
  • booya
  • bosco
  • braille
  • branch600633.fairstone
  • brayden-ut0801
  • brjisew
  • bukitbesar
  • burns
  • caleb-xa1001
  • carlos-rt1301
  • casa1
  • cj61nelson7o
  • com.ref13
  • cosca
  • danone
  • del-one-actvthelp01
  • dfiu
  • dildx
  • djc2
  • dmwosmwlqu
  • ds80hernandez5s
  • dssuk
  • dunsvihcontpoo
  • dyzabnqhch
  • dzalike
  • e3ahfee4a
  • ej32williams3h
  • emb80
  • engracado
  • essaywrchj02
  • essaywrldm00
  • essaywrmvu76
  • eugimdidc
  • eugwyuapvenv0rl
  • ftp.del-oneupdatev1
  • ftp.desertfinancial-secure01
  • ftp.google462pl
  • ftp.host-paypalmyaccount
  • ftp.mista
  • ftp.secure07cinfos
  • ftp.support2-delone
  • ftp.uspostalredelivery
  • ftp.verify-account201
  • ftp.writeessoqp86
  • genlogapi1-adminer.dev.mahakaruna
  • gz.ipip
  • hy63clark9h
  • ictech
  • idsuporte
  • iforexfraud
  • indofly
  • ip
  • it01turner3d
  • jfcikuuq
  • johanleroux
  • josiah-ey1001
  • jzkgftdn
  • kevincam
  • kimono
  • klarna-security
  • knight
  • laser
  • libetmaf
  • lirikchordmusik
  • ljirida
  • luketina
  • mail.kangen
  • makina79w1
  • mascolointernationalhairdesigns
  • mbx2701
  • mia-ay1301
  • minimalista
  • mischwerk
  • mmx.wincex
  • mnanibuo4ek
  • mogiyit
  • msch
  • msdns
  • myecu-support4
  • nairaner
  • nathan-gn1401
  • nd18nelson3s
  • networkpro
  • nevada-ib1401
  • nfm
  • nhan
  • nicolas1984
  • nonsbator
  • ny
  • organizada
  • oukofqfjj
  • pacek
  • packer
  • patreon-amourant.fowce29ovys
  • pfgkxjfdylb
  • pocket
  • portcizuti
  • prefix
  • provendete
  • puntointerrogativo
  • rakovec
  • rapikebumen
  • resetcitizens
  • restoration-secuirty
  • ricu2807
  • rreballonwoerner
  • safari
  • safediluz
  • saude
  • scufelayakido
  • sergio
  • serviceaccount-info03a
  • shense.hkr
  • sidecar
  • skillnaden
  • slowolff
  • software
  • somewhere
  • sozohipuwou
  • storge
  • suncepfoq
  • swritebem77
  • swritefmk15
  • swritezpi79
  • tn
  • tqdjtbjo
  • upwork
  • uufujobieszii
  • valeria-jd0801
  • vdm
  • verify-occusec
  • verifyc455-secure
  • verifych3b-secure2
  • veriify-53logsecre
  • vhidf2hy
  • vilavelha
  • vovatkep
  • vumifed
  • wboovxuakyuuhgie
  • weathers
  • weber
  • wezasod
  • worldtech
  • writeessiyy58
  • writeesslbz31
  • writeessmpe66
  • writeessvlc36
  • writeessywk60
  • www.1c3c8ousk
  • www.243guante
  • www.account-o7-secure
  • www.arilmaqmatriz
  • www.bag
  • www.barn
  • www.bmi
  • www.cbq8459
  • www.chase-bank
  • www.chongming
  • www.common
  • www.conwieforcui
  • www.del-oneloginlive
  • www.duoluoxue
  • www.eder
  • www.fifth-thirdverifyacc
  • www.helpdispute
  • www.hfchost00
  • www.hiho9aoj
  • www.im0ml9tk
  • www.josephlewisq43g
  • www.lojevezudaledek
  • www.mise
  • www.ncsecu-org-click
  • www.orange
  • www.ovdmchvcla
  • www.sh83walker8a
  • www.ttg
  • www.vaxo
  • www.verify-vantage-westcu-user09
  • xiedo8uy
  • xwjjvxex
  • zibih
  • zxss0104
  • autocar
  • ftp.industrium
  • horsezebra
  • iferb26
  • loss-3399
  • macchina
  • nippo
  • pj83mitchell4q
  • trafficstars
  • trucacmusca
  • universo
  • waw
  • wliqu1en
  • www.yogosuc
  • xg64turner6j
  • nmxvb
  • swritevqm85
  • customersuppppurt
  • ddn2.samwss
  • ftp.streetwise
  • ftp.ukraindh
  • mail.chasseveri-ident
  • shoptuanz.shopgameff
  • update-secure-info
  • dash.fourretout
  • ftp.del-oneauthsuppt01
  • 124830sc
  • 24accupdted
  • 2i6388
  • 5872223145
  • 675bd28
  • aaliyah-zh1301
  • addison-bd1301
  • adjioad
  • aidan
  • aubrey-ru1803
  • aussies
  • avdfzbhdfcfqm
  • becas
  • blackpine
  • boaretti
  • bodibogn
  • bowie
  • bp20robinson0t
  • bplus
  • capagararwe
  • celcios
  • coopermedc
  • cuamericauser3
  • czfjjvsgqi
  • daenerys
  • damavik.zhylko
  • dan202streetradio
  • deturi
  • dituraw
  • dunbar
  • elizabeth150112xt
  • experimentar
  • f38rjr3
  • faacts
  • fau
  • florida-ow3012
  • fpvkplenuj
  • ftp.brianhallg83s
  • ftp.cloudstorevps
  • ftp.lawguys
  • ftp.lirikchordmusik
  • ftp.michael4
  • ftp.redirect2auth-web
  • ftp.sesbellforly
  • ftp.verify77-secure
  • ftpojulcezhdo
  • gavin-bw0803
  • gerald
  • gerddersa
  • godzilla
  • grob
  • hadoopio
  • hala
  • hecrapasi
  • hernandez
  • hgiq286ai.michonne
  • hipster
  • hkvpn18
  • howler
  • hut0
  • hxwwf27
  • i2548
  • ikyklgajyp
  • im
  • indardi
  • iqaammeoue
  • irlemiev
  • itanetitai
  • jacksmasactascons
  • jaff
  • ka1fe5
  • kbusim1406
  • kentucky-bo1501
  • kms0t
  • kya
  • kynance
  • lalique
  • landon-mb1301
  • leanne
  • leterfutu
  • limegumdi
  • liwomia-mult
  • logo
  • longco
  • lorilay2019
  • luisjosedede
  • mail-gate
  • maker
  • mary-cv0905
  • mgbllxladebcn
  • nenulebar
  • newguidexx
  • nitip
  • nseydcbqsc
  • oepequv
  • paulc
  • pcv-s520
  • pokehacks
  • pssz
  • pujowek
  • qp9ji4gb
  • radicaboss
  • rayko
  • rbayutbeyovenogc
  • regionald
  • retefin
  • rqkkxns
  • rsmb
  • schumannsystem
  • secure09chase0
  • security-info12b
  • seisia
  • sollyp
  • sparky
  • swritemhq73
  • swriteqot19
  • tattooed
  • tell
  • tennessee-hd1201
  • text
  • th3v3jz8js
  • titen
  • tm
  • topaz1
  • tyler-si0901
  • tysorahylo
  • ulisses
  • uosinjor
  • v3-amazon-order
  • vardas
  • vc98johnson9y
  • veriify-5n3hostnet9
  • vst
  • wild
  • wingkongr2
  • writeessryn77
  • writeessxpu84
  • wuzzbiyihc
  • www.5rd-securee
  • www.alertsnotifywellsfargo
  • www.amazonsitesusa-verificationspage
  • www.anais
  • www.cam2
  • www.carpinus
  • www.dev2
  • www.giuhydleiga
  • www.gvg
  • www.iwb81u
  • www.khanhson
  • www.mikro
  • www.muscolosi
  • www.myroom
  • www.netflix-securebillings
  • www.noone
  • www.piscis
  • www.rimjk
  • www.scre
  • www.sharefb
  • www.tiorich1306
  • www.vantrung
  • www.yyuwohksvu
  • wyoming010212se
  • xhd
  • xurltssbfq
  • xxoo
  • ys36evans0a
  • yuotkaeskeunu6rp
  • yzpc
  • z4chacha
  • zalu2019
  • znldjwrqjp
  • 0045f8
  • 4u9ohs4
  • alexandra
  • asset
  • azamb
  • cvlisa301
  • dampdawn37
  • dzrhy
  • esther
  • freemax
  • ftp.bh
  • ftp.detective
  • ftp.globalsistemas
  • ftp.produccionesasfalticas
  • hohnernj
  • inv
  • ironman
  • iwok
  • jhdystu
  • jl72walker5u
  • landon130112ym
  • lhe87217
  • lhr
  • meridional
  • mugity
  • ontvangster-p0rt
  • saldedis
  • sioskomenmig
  • sx1markl75
  • types
  • william-yj1201
  • www.ironbook
  • yvlbodvcs
  • 7i228fg
  • absolutebangla
  • autoviape
  • charki0406
  • checkmk.mein
  • cooperativa
  • coronet
  • danw7
  • essaywrgks87
  • ftp.fs
  • ftp.groupyoutuber
  • jd12white6h
  • mens-8995
  • ontvangen-informatie
  • pm
  • pob17.opt
  • retrack-uspostal01
  • vicantec
  • wk59wilson7o
  • www.cverifyc67-secures
  • www.educatorssupport4
  • www.securedaccount7b6citidata5
  • www.account-verify07
  • cgageosrv.alia
  • hiyoung
  • tripolanti
  • terphohogobb
  • 4093o9q
  • asdfhters
  • chans2
  • dirbas
  • ghiingzpqsvi
  • herutanomai
  • ikezu4aj
  • theft
  • www.peachesunicorn
  • www.secures02a
  • www.zzqyodntvl
  • 5p982
  • ac3lmwp
  • amadeu
  • angelochagas
  • archlinux
  • auchhome
  • ayesha
  • bumpers
  • cbxyrtbibz
  • christian-lw1001
  • cs
  • dev1.vnbkyd
  • digen
  • effortless
  • essentials
  • excelfile-z2
  • ftp.authyour-srp
  • ftp.shuangye
  • galois
  • genesis-im1101
  • hf
  • homecloud
  • ik30turner6y
  • jacob-pf1501
  • jejpokfjruekdlb
  • jelly
  • jol
  • ke1v68jlb2l
  • kennels
  • littlekiwi
  • magnum
  • mail.herisson
  • markas
  • markegp
  • motherland
  • news.bounty
  • nomnas
  • orionis
  • pood1
  • rqe3t02qak
  • sag
  • secure0nlineacc8
  • shadowhaven
  • sith
  • springfieldminutemen
  • sworty
  • swritefcr91
  • tn51hernandez2s
  • trainer
  • urbn
  • vara-ha
  • virginia-sw1401
  • vpn145
  • wehx
  • www.essaywrvtd63
  • www.hd3mv3en
  • www.jmxx
  • www.myposte-verifica-prepagata-postepay-id-00281
  • www.secure-verifysc07
  • www.secureauthl0gin
  • www.sms-msg
  • wyer
  • wzsupuiw
  • xrco2702
  • 2i9t3w0h
  • 6827
  • abelpereira
  • adconnect
  • ameasboabrisra
  • americafirst-app
  • awome7om
  • axzlopenk
  • blushine
  • bo8uum6cvu0k8
  • c7a5e-s3cur3
  • caleb-et1201
  • cam95
  • cancelchase
  • canet
  • carlos-el1401
  • charlesjonesg67k
  • cineredepok
  • comin
  • corrairouhi
  • dan53streetradio
  • daniel-aw1501
  • e9apxa2r
  • easer
  • ebony
  • emmy
  • estepona2013
  • failu
  • fejalabe1811
  • ff-advanceserver2
  • fis
  • flexible
  • flood
  • ftp.charlied
  • ftp.essaywrdvp25
  • ftp.essaywrsxx37
  • ftp.imgenes
  • ftp.rt73gonzalez8d
  • ftp.secure-hub-service
  • ftp.verfy-van
  • ftp.vrkzjqfugx
  • goodyear
  • grenada
  • guisoviljaa1811
  • hamilton.treehorn
  • harbor.mahakaruna
  • hintergrund
  • holagpis
  • ifuturo
  • industryproduction
  • jay101
  • kaylee-rt1101
  • kmoe8itu
  • kohls
  • ksis
  • ku30perez7a
  • latha
  • liam-mc0201
  • lib.lnnc
  • mark1
  • marnep
  • meier
  • mhsnjlqze
  • mint84090901
  • mjjsgk91
  • modro
  • mosigitqemoyra
  • n8p3lek
  • nevaeh110112tv
  • nicole-nx1101
  • ovoo
  • ozulssbzlqcgq
  • peint
  • peticmita
  • pl.bellt
  • proj.bevin
  • pyubrflbha
  • qaayo0ab
  • qigcieotlkveiicy
  • query.e2evantage
  • riacenrecpetdig
  • rkcarcbudo
  • romaincarnac
  • sat
  • shb
  • simone93
  • sok355q
  • taylor-kw1201
  • tcapii
  • think
  • tracktrace
  • trustme
  • utehi26
  • v362nkf
  • vantagewest-acc4
  • vapidserver
  • vfieimlocecesijp
  • vkuvkhhalxcm
  • vrkzjqfugx
  • wape
  • we0r11y
  • webmail.groupwhtsappbokp.00
  • wj43lewis7r
  • wmax
  • writeessbqk22
  • wsf
  • www.44ajud
  • www.ad07doc12
  • www.amir
  • www.del-one-verify01
  • www.discover-cardservices-online
  • www.dmh
  • www.dns-gate
  • www.fnikufluoopogatw
  • www.ityo10
  • www.j932
  • www.k24petaselatan
  • www.klohgoknvt
  • www.knivesxoo
  • www.lag
  • www.lt93edwards0v
  • www.mipag
  • www.my-ecu
  • www.postepay-poste-securelogin
  • www.secure-07account-info
  • www.secure-citi05
  • www.secure04bchas3login
  • www.sorafogueihtumln
  • www.tom
  • www.watchessoo
  • xone
  • xsoilked
  • z5yaeb5
  • zb.tc
  • zg15roberts5w
  • zphvxqb
  • zs21garcia3d
  • zwdhtxbr
  • www.caeddserv-card
  • cristiano
  • bb8
  • foto
  • funessrv.alia
  • homeservernewslater
  • jitsi
  • securityupdate
  • um1.serv1
  • whatsapp-grupinvitebkp2020
  • www.shop0k
  • 4298p
  • 88k6tl8
  • 9n7s5b6k8i
  • angel-jz0902
  • antico
  • ardig
  • avp
  • bandwagon
  • bendakaya
  • benton
  • bhayangkara
  • boot
  • brayden-ee1301
  • buildai
  • businessweek
  • camaras59a1
  • care-myvantagewest
  • cavani
  • chenssoundnages
  • crillon
  • daddy
  • daf
  • dan194streetradio
  • dan94streetradio
  • danielgreent94i
  • depot
  • distinct
  • e-supportdocos
  • ecusupport-n
  • ef99hill8z
  • elad
  • escape
  • esperance69
  • essaywrxuh88
  • estate
  • etvo
  • feramr19
  • fernsehen
  • fihvvpbz
  • filial51
  • fkluy
  • fogeablasi
  • foodreformcoalition
  • ftp.cucupati
  • ftp.infosecure-verification
  • ftp.kzidqtqbbx
  • ftp.paulodefreitas
  • ftp.ushelp-verify
  • ftp.verify-account-info
  • fudupanwoj
  • gagozyvi
  • gary
  • geekintosh
  • gilaverob
  • gmapp
  • gtngermany
  • harperwasham
  • hunter-vo1401
  • hxliukulvf
  • isis
  • jcl
  • john
  • john070112qf
  • kind
  • lajulezj
  • lakelandautoinsurance
  • laumenmorlide
  • lejowwofr
  • lh22lopez1j
  • lucille
  • ma38allen7q
  • mail.cliknow-whatsapp.00
  • mail.diamondfreefire-free.00
  • marcelopassos
  • materias
  • mexe5sol
  • mighty
  • motion
  • mrdiykpo
  • mtl0
  • nayajbom
  • neo02
  • neverland
  • np63green5n
  • octobox
  • p8a2ipr
  • panfiredcatering
  • paulhally29h
  • pdm2801
  • perve0406
  • photos.dethstryke
  • pucezieq
  • qlnqe
  • rdllll
  • recordings
  • rigriummeuznqiuh
  • rowell
  • ruag
  • samuel-gw1501
  • silicones-pickled
  • slava
  • smarttech
  • smblanco
  • sophia220112sb
  • steff2103
  • struts
  • swritekka65
  • swritemmi26
  • swriteugq93
  • swritezvu14
  • tedaz
  • tf72garcia6j
  • tfc0104
  • thimm
  • tok
  • truistm0bile1
  • tsbecej
  • ty
  • ub66perez9p
  • vakehrtalte
  • vazquez7
  • vedozl
  • victoria-ax0803
  • wang
  • webdisk.pulsaku
  • wimax
  • wn56qaiunx
  • writeessoqp86
  • writeessrbv02
  • writeessxmn60
  • www.1
  • www.changeip5rd
  • www.cikini
  • www.clip-msn1
  • www.downloads02.arquivo4453
  • www.dumoxd
  • www.essaywrahl04
  • www.ewrus
  • www.exitwh
  • www.ijaki7ak
  • www.iota
  • www.kalaamafcu6
  • www.leyreijorso
  • www.lucole
  • www.ncsecu-org-logins
  • www.parcelreshipment
  • www.postepay-myposte-portale-titolari-servizionline-pos-vrf219kkcs9
  • www.promises
  • www.rootcloud
  • www.sec9x-verifysupport07pj
  • www.secure4-account
  • www.serphan
  • www.sijold
  • www.ten
  • www.verify-securec07
  • xeriklo98
  • ysw
  • zewipiiw
  • 1802
  • 86172477
  • amazonsitesusa-verificationspage
  • app
  • babystorex
  • bpekutfsvkck
  • ftp.essaywrlpj65
  • ftp.hers
  • infosecures07
  • jdxbrxe
  • kinneymotors
  • krypreph
  • moaffgzt
  • unepic
  • unifywaxen
  • vh26hill1r
  • watchers
  • www.custservice2ecu
  • xxxkasim
  • account-verifysecurity
  • amanah-natdawadee
  • amfcu
  • atarcemi
  • audioshopxa
  • cemureruxogososoroqese
  • cex79a3i
  • clancampbell
  • conisicla0905
  • d91d7d
  • ds-mad
  • easton-vb1001
  • edocos-system
  • ewgenij030580
  • ftikojzomoad
  • ftp.locarosi
  • ftp.luvdimuk
  • ftp.security-info12b
  • hoko
  • hung
  • ihzgp
  • iowa-yw1401
  • jdicumv
  • john-ce1401
  • june84120901
  • khaophrawiharn
  • ktlvtqknzh
  • liam-nd1201
  • mail.screenshots
  • mail.whatsapp
  • mj6b0ikbuo
  • mybbtu
  • nadil
  • nan80020801
  • newdelone
  • oaxaca
  • ojefaruti
  • penguins
  • pondlife
  • pr
  • rgba
  • seafile
  • server79uk
  • sleep
  • sr44allen1c
  • swriteqge99
  • terence
  • terriers
  • tina
  • vspevjghhcby
  • www.babystorehq
  • www.clemsysmisa
  • www.mila520
  • www.myposte-postepay-online-securelogin-bp
  • www.ncsecu-org-declines
  • www.secure-verifyform
  • xj1qm1no
  • activities
  • pregnant
  • fargo54-secure
  • ftp.eder
  • ftp.mathieu-jodar
  • goodgrainoil
  • joingrupwayoutubersff
  • neverchanged
  • stho
  • trutt
  • webmail.sec02
  • www.csgabor
  • www.kaulketh
  • www.shop-indomaret
  • www.verifyc0s8-secure
  • 0d8
  • 0n4n8oovv
  • 26
  • 35rh2w23
  • 4973575
  • 8mm
  • abemrodog
  • accountinfo-secure
  • afculoginlive
  • agreement
  • ahoysahyaqy
  • aklbntkjcxy
  • ales
  • apx
  • asami
  • attract
  • aunober
  • australien
  • b1v2c3
  • brianna-ow0901
  • bynykonadffj
  • c0wb0yhome
  • cadera
  • carmel
  • chaniss
  • cjnet
  • colirene
  • congfuncgoh
  • consulting
  • cr94carter7o
  • crawfish
  • crms
  • dan156streetradio
  • dan26
  • danex
  • del-oneupdtect2
  • delaware
  • docent81
  • doki
  • dsretsaghuisajdas
  • ejnlwe
  • equivalents
  • er3jeffyr2
  • essaywriwk83
  • essaywroip34
  • exzcolnyt
  • fccsingapore
  • ftp.bankverify4auth
  • ftp.clinentweb2
  • ftp.diamondffgratis
  • ftp.fx32campbell1i
  • ftp.k24rengasbandung
  • ftp.nieves
  • ftp.ovexlioupa
  • ftp.secure-server23f
  • ftp.secureyouracounts
  • ftp.service-recovery
  • ftp.titronhk
  • ftp.v3j3axs
  • georgephillipsl10s
  • givadew
  • gt
  • guawixared
  • h3eswvbs
  • hattaway
  • heloisapenna
  • hourou-corset
  • howm
  • hql91
  • hzmcvtvqnqah
  • iceblock42
  • internetgoldner
  • jmzas
  • kalaamafcu6
  • katherine-de2403
  • keve
  • kevinandersonk74p
  • keys
  • klocker-mark
  • koiujhytread
  • leslie
  • lexmark-scholastic
  • liam-ij1301
  • lingerierescue
  • luisberni
  • luweiji
  • mail.ell
  • makai
  • mantovani
  • mariocl
  • meen73221101
  • mekcompcheaps
  • metrocu-org-reactivation
  • mfb
  • mgry185
  • michigan-eq1401
  • miguelgeek
  • minkom
  • moje
  • mokuhsaef
  • mrmecpdlgrdbpfpc
  • mupi
  • myfiles
  • n111u
  • n7uvko0m
  • nasusbuc
  • nat04061101
  • nicholas-ij1301
  • nickys
  • oananel
  • okfwqre
  • onanonymous
  • ow
  • paola-ue1101
  • penn
  • plaanet
  • planety
  • pmuo
  • protection-sensitivity
  • qeskwz
  • rbyayrwady
  • reikimicalement
  • roassted
  • rofiherli
  • rztlyyqyndw
  • samantha030212yg
  • secure-user-verify06a
  • secureaccount-amazonsiteusa
  • semara
  • showdetelhasgp
  • sogoodnj
  • spa
  • steel
  • suncoast09secure
  • svn.braineed
  • swritelek44
  • telephotostorehq
  • tpwifi2
  • tsh
  • tulare
  • turnpike
  • tyson
  • uk.coosa
  • una
  • updates
  • utah-xb1801
  • vacfrvbvmx
  • vbmvyhmikn
  • vc2jx0rs
  • vg75.acc
  • vm130.ingen
  • voile
  • vwghieurdylpf
  • vwrzr
  • williamgonzalezr09u
  • wmclinic
  • writeessiyz47
  • writeesskql33
  • writeessorq66
  • www.5d7rg2o
  • www.68ehbg
  • www.bcube9ov
  • www.cyberflash
  • www.dan33streetradio
  • www.dc
  • www.e2c91836
  • www.esordecent
  • www.groups
  • www.hafusraj
  • www.kanat
  • www.kikdjb
  • www.mobil
  • www.qghsr24
  • www.swriteroh13
  • www.tegk3
  • www.verify03usatsecure
  • www.wks
  • www3-mtbb
  • xehoqifqok
  • xeyokufavo2a
  • xjkqol
  • xtream
  • xyaya2up
  • ydvczmmhfy
  • ykinoj
  • zoey-no3012
  • ztulc
  • 84728
  • awu3y0
  • bd4bs
  • consulcesi
  • deneckerm
  • diego-mk1001
  • elimavma
  • essaywrdvp25
  • essaywrkqh62
  • fario
  • ftp.continents
  • ftp.ogn
  • ftp.zealous
  • g00dman
  • gualeguaychu
  • htc
  • irving
  • johnny
  • kuanhsien-host
  • l3f1urz
  • missouri-ub1501
  • nqg570191
  • oospinaa
  • postepay-verifica-dati-personali
  • pzofqy
  • rata
  • swritemqj30
  • tmp.tramnhien
  • tupelo
  • verify-citizzenss
  • vv87green5q
  • webcatulea
  • www.govvato
  • www.oeil
  • www.writeessata16
  • ypoo14
  • fpihe9iq
  • ftp.cheacommorrre
  • island
  • udes
  • vista
  • www.kxsrqquoqsrn
  • firstthekingdom
  • bigi28
  • chasecure-upload
  • ftp.app-updte401
  • nettaquaral
  • pepsmedia
  • skullhound
  • 6f4c
  • adobereader-file
  • aecud
  • aksharleesburg
  • aliafifi
  • amber72
  • ao01lopez7x
  • ashley-io1601
  • camden
  • christopherlopezb54q
  • cnlkqsvprx
  • coald
  • cverifycco55-secure
  • cycle
  • da72170701
  • dedan
  • dztmw
  • ebhqp
  • eiu2eyt8ik
  • em08adams8n
  • energistics
  • essaywrlsn14
  • essaywronb97
  • ftp.bintangfarma
  • ftp.campanie-email
  • ftp.floe
  • ftp.galdemar
  • ftp.maier
  • ftp.mazdaphahol
  • ftp.oxtalesuk
  • ftp.verifycase07-secure
  • ftp.writeessqyn00
  • fyq3720
  • gitros
  • healthserviceauthority
  • hekman
  • hgmbokohizaalg
  • incae
  • iobibtefo
  • itsme20
  • j18z
  • jam2
  • juan-xc1301
  • jvkcqyqdoqj9wa
  • jzy
  • kos
  • lag
  • lanos
  • lc06allen2s
  • liam-st1301
  • lolillo
  • m2iqgo2y1el
  • mashitr
  • membrane
  • meulink
  • mizuno
  • moroz
  • ncds
  • nfede7b2l0
  • nolit
  • nozzgakelebot
  • nwuda8uk
  • paomontmagny
  • pattanan
  • pero
  • pichel
  • pombas
  • prints
  • prodan1306
  • rie
  • s3cur3-7nf0
  • secure05-information
  • secure09-fifth3rd
  • secureconnection02-wellsfargo-verify
  • sergio1
  • serversecureaccount
  • shawinigan
  • stigma
  • syringa
  • toonvl
  • totaline
  • ttxik
  • tw92phillips5m
  • vacuum
  • verify821-secure
  • verifyaccess005
  • vfryxaioo
  • vque
  • washington
  • wf71evans5d
  • wisconsin-we0303
  • www.albatrossop
  • www.beautyline
  • www.citizensonline
  • www.efootball2021mobile-epoint
  • www.fourbiste
  • www.itemff-free
  • www.lnweb
  • www.mallofindonesia
  • www.secure09
  • www.shopthangff
  • www.swritezpi79
  • www.tablet
  • www.taker
  • www.validate-53ccsercm
  • xzhfo
  • yffpsybfwh
  • ylcf0802
  • 0b7awr
  • 1rv98fu
  • 7412
  • aaliyah-nz1301
  • acidmodels-hack.botte40dullrea
  • adriana-mh1401
  • af
  • agaroqzxbd
  • alban6666
  • andrea-tk1401
  • apollon
  • artemo
  • atelier
  • avon
  • banda
  • bed01.qubo
  • bestri1406
  • bhojsyntamar
  • burgie
  • bwm0103
  • cantillon
  • caresle
  • casadvr
  • catworld
  • cfkr.dycwuxing
  • chained-horitatiax
  • chase
  • chet
  • chipxd
  • cleric
  • corona
  • crihnvs
  • cxaoprcjthrooo
  • davew
  • davidwilliamsk53k
  • dogonin
  • ecclicinon
  • eewqsotlyrxyjeq
  • fig1003
  • fizzical
  • fracdisridug0905
  • ftp.espia
  • ftp.gateway-core
  • ftp.mareheti
  • ftp.protect03didentity
  • ftp.swritebre91
  • ftp.verify2b-alert
  • ftp.xa12-secure-verificationn
  • ftp.xh26campbell7x
  • gh009
  • grace-gh2702
  • gunungshari
  • is
  • jaszbuvar
  • jfjzc0k
  • jobayimi
  • kick
  • llm
  • luach
  • lunas
  • magno
  • mail.glas
  • mail.istanbul
  • mail.refurbished
  • mail.vis
  • marboni
  • mdive20
  • medvedev
  • meen44100201
  • megalink
  • mopor1306
  • most
  • mushroom
  • nebraska-bb1401
  • novartis
  • one7
  • plamspa
  • postepay-verifiche-online-024559
  • reba
  • rinivalrent
  • rossi
  • sebastian-gt1301
  • sesbellforly
  • sirada79211812
  • spooky
  • stevengreena32n
  • stzeuqqu
  • swriterlz23
  • trixi
  • utah-en0101
  • vebatzunttx
  • vg53.acc
  • vredboilsa
  • vwoqe7ip
  • w9g8uk
  • wftelecom
  • winestorehq
  • wr703n
  • www.fcnori
  • www.hofmann
  • www.homeart
  • www.modellabile
  • www.pm
  • www.rear
  • www.robertgreeni78a
  • www.ruhim
  • www.secure-account07g
  • www.secure-portal-out
  • www.secureauthacct
  • www.sm31wilson1d
  • www.stcnq12
  • www.supersxoo
  • www.th6brianl00
  • www.veri7y-c7a5e
  • www.verify-citiznsclient
  • www.vika0
  • www.ziehelidi
  • zero
  • zhop
  • zizufotidaleni
  • dms
  • marty
  • mtb-logins
  • serv-tx
  • signinapproveclient09h-facility
  • www.helpdesk
  • 37276gepey
  • baservmrvtcalyxa
  • brianrobinsona72a
  • essaywrtbv54
  • fm
  • ftp.followtherules
  • ftp.qqftcygzvk
  • ihwsrhfzes
  • localdomain
  • macixxir
  • mkworld
  • n18u.pepsi
  • nassere
  • nqeorg3jz5nbk8
  • serviceaccount-info07d
  • ulk4ddwyi.michonne
  • voygrasac
  • y0ebhtoa1me8o
  • 0f4p4sa
  • 0r3sa7m
  • 1228
  • 207161h
  • 28bz3l
  • 3x8oai
  • 6t55cot
  • 6xe2yuv
  • 79mrnn
  • 92683
  • aanaansie
  • altudi
  • an10gonzalez9g
  • angel-aq2912
  • aristonfoods
  • arrowhead65b
  • atsstfgyv
  • aurora41
  • branch640699.fairstone
  • branch650033.fairstone
  • brantpc
  • breakmoi57
  • bt2ovhwe
  • btravel
  • buluj6l0eebh
  • c2i5x6f5n8
  • cake
  • carter-dv1101
  • cf139
  • chula
  • ciseajvwlg
  • citia0uthsec3ure
  • cj50scott0k
  • clearadciania
  • connecticut-cm1301
  • cqyqf
  • dacejar
  • dculogin-web
  • dedsecvn
  • del-one-infoaccess1
  • del-onefcuview
  • deloneusersupport2
  • dgcyfrezkjpqbs
  • dharm
  • dhdguvlhnt
  • dqinpq
  • drop
  • ecoserv
  • edaikasa.nesplu
  • en2
  • ergb234r
  • escorpion
  • essaywrjwd38
  • fantasticraybanqdg9
  • fett
  • fleece
  • focus
  • ftiuzzmqixbmc
  • ftp.account-security
  • ftp.btcatn
  • ftp.chaseonlineverify
  • ftp.eliosequeira
  • ftp.getmanoba
  • ftp.jaxesayuguah
  • ftp.johnrodriguezp66b
  • ftp.mrdiyppj
  • ftp.online-banking-secure-signiniur1
  • ftp.richardevansq01g
  • garryweiner
  • gasshabsterpsi
  • gtech
  • gwyirqpsya
  • help-srpcu0
  • hgmniqakvj
  • hlnet
  • hs1s
  • htv3
  • hust0402
  • idqc5ws9ff
  • ipqtecnologia
  • jack-vs1201
  • jaguaripe
  • james-zu1501
  • joshua-yv1501
  • kaheqhoqi
  • kanokwan08172512
  • kepejwuy
  • kevincampbells10g
  • kik02101001
  • kiriysop
  • l1ete1z8ow
  • lafayette
  • lapd
  • letsalllovelain
  • lfsewouhrlfoeuoo
  • listed
  • ljnhyt05sb
  • loccagarden
  • mail.exercise
  • mail.rabo
  • marona
  • matthew-ua1001
  • mature
  • maxvpn
  • mnms
  • mu5ao2xx
  • myecu-help
  • newpacapi
  • niveoonoqihmohsv
  • nuta1ret
  • oakz
  • oddballout
  • onffuqjfoxiqx
  • onscreen-nw2
  • ousorz
  • pastiera
  • pauline
  • pfh
  • poefonc1006
  • pogorelov
  • polega
  • postbox-tracking
  • postepay-aggiornamento-obbligatorio-id220147
  • pradtelecom
  • pratinha
  • qg10white7k
  • qqftcygzvk
  • racswim
  • ranking
  • rbgmdnvoeo
  • rbhome
  • re63utuukz
  • redy0908
  • regbyu
  • retilno
  • ricks
  • rmhome
  • rtqdhbhwak
  • rtsds
  • santoleo
  • sarighiol
  • savannah
  • sec-icheck-39es
  • secure-verifyaccount
  • select
  • shamokin
  • since
  • sirada87180301
  • smell
  • sona
  • sophia160112kt
  • stinmittcalkemp
  • tegk3
  • theboss
  • tmg
  • tmnet
  • townhomes
  • tr90baker7l
  • ty80carter8r
  • ualison
  • universo1
  • unseen
  • uy485s
  • verify2vlogin
  • verifyscd03-secure
  • vitordesp
  • vw13perez2w
  • wan1.shenyj
  • wdova1ab
  • webnet2
  • wendys
  • wingowong
  • woollahra
  • wrbrd
  • writeessfsw05
  • writeessyry47
  • writeesszpn23
  • www.afdn10
  • www.americafirst-com-secure
  • www.badges
  • www.barrymore
  • www.cangkirgading
  • www.client-infoapproval03d
  • www.dsataitozuliiorf
  • www.feminista
  • www.gora1sox
  • www.gxeyuzc
  • www.h1afqo0j1uq
  • www.iredeem
  • www.ncsecu-online-help
  • www.ncsecu-org-secure-account
  • www.nfsesantaines
  • www.novainternet
  • www.reciclados
  • www.route-delivery-67
  • www.ruvds
  • www.secureo0verify-account
  • www.sgavo1ob
  • www.signin08z-authenticatedata
  • www.slidernet
  • www.sukatv
  • www.ux8charlesb41
  • www.veriify-53apiseclog
  • xhdrsjdsgq
  • xoono0ic
  • xukaj
  • ypynk
  • zo71rodriguez3s
  • domain
  • www.morte
  • paraiparkolaria
  • src-helpsupport
  • www.shopgameff
  • erik
  • fersewqam
  • georgia-fh1001
  • gerriko
  • iauekrxcgsb
  • servicehelp-ecu4
  • swritevti51
  • www.marvelous
  • 086a05k
  • 5i4b7r2i8l
  • 6uz99
  • aknqmpfj
  • aso1.mem
  • avt
  • bleeker
  • dglerbpknpdswqe
  • dichvucodes
  • donny
  • download5255file
  • duplex
  • elphi1406
  • event
  • filial17
  • ftp.customizados
  • ftp.dakakipy
  • ftp.eventfreeordergarenafreefire16november2020tersembunyi
  • ftp.free-bundeltitan66
  • ftp.jfgag
  • ftp.swritebum64
  • ftp.theaddress
  • gates
  • gsiki2ic
  • iacosviks
  • jackbookpro
  • julian-extern
  • kobe
  • kundenlogin-dkb
  • landon-et0403
  • luxury
  • makayla-ub2806
  • mariway
  • mccus
  • mkk
  • msxnecxubu
  • mygovauthen3
  • natuurtehuur
  • netgear
  • paypal-inc-italia
  • postepay-myprofile-aggiornamento-obbligatorio-vf-108iktth00
  • qi40lee3u
  • rcfc
  • restoreaccount
  • ridgid
  • sjkqytvy
  • snlfw
  • spicfinesze
  • stomk
  • tyuf
  • ukzjzgjhsjajcujhghhkhhsbtcfkj.frek890
  • volare
  • www.auth-del-onehlp
  • www.guinuphe
  • www.jose
  • www.secure001-verifyprofileinfowf
  • www.thex5
  • www.universo2
  • www.verification-chase025b-securityhost
  • ashley-ir1501
  • walterosorio
  • 1000kuhon
  • 10031
  • 1201
  • 1300
  • 2hi265
  • 4x4
  • 7xch1rh8p12
  • 9dl2iv
  • abdmcjb0584emz
  • aclcudbestu
  • adventure
  • aiievdrbr
  • amanda-xg1401
  • ambassador
  • barotraumahispano
  • bbh
  • bbirwypfounq
  • bids
  • bigt
  • bm34taylor1w
  • brookstone
  • butch
  • bwncel
  • c97121677
  • cagephysi
  • camera
  • celebrate
  • charlied
  • chase-bank
  • citizensbank-help
  • cnetartikel
  • cspencer
  • d08.gm-d
  • decorate
  • descendant
  • devujik
  • dollard
  • dunya
  • esosphera
  • essaywrhld79
  • essaywrhmu65
  • essaywrnsl64
  • essaywropa39
  • essaywrrem05
  • essaywrvtd63
  • fai06010701
  • fauvel
  • feat
  • ffyguufvji
  • ftp.auth-secured-citizensbankonline
  • ftp.essaywrvgj34
  • ftp.info-secure-account
  • ftp.literela
  • ftp.secure07citiweb
  • ftp.secure08citiweb
  • ftp.skinpubgs17
  • ftp.support5rd-acc
  • ftp.vantagewest-cntctasst
  • ftp.verify-vantage-westcu-member04l
  • fzbuozw
  • ghirop1306
  • greenmarket
  • greenplace
  • gttwjoskxh
  • h7pytmb1
  • hck
  • hecktorus
  • hguhu7eh
  • hooktheme
  • icbc
  • iuqiqudzei
  • johnalleny64a
  • josephwhiteq84t
  • jtfidje
  • julia-in1401
  • k8tdwguure
  • krasotka.i1
  • letusbank
  • loyalquality
  • luis-na0901
  • lulihalfgeh
  • lv18lee9q
  • mail.department
  • mali1208
  • manitoba
  • michaelmitchellz87a
  • missouri-uf1301
  • moore
  • nerc
  • nona
  • nx51clark0f
  • object
  • odcxgtohj
  • olivia-cl1101
  • outneumemo
  • owyigjlfumys
  • pblr
  • plantecrecife
  • plym
  • poker
  • poste-verifica-dati
  • qbynccgk
  • rno
  • rosell
  • rue21
  • sauvignon
  • schorr31
  • sdfdsdf
  • secure01a
  • sejp
  • sikalrep
  • smartt
  • smeal
  • supernet02
  • superrede
  • sustainguidevf
  • swriteaqb54
  • swritenqx91
  • tennessee-qq2602
  • thg
  • thronkamasli
  • toddlerv
  • uicbarcelona
  • vegan
  • verifiche-posteid-postespid
  • verify-account121
  • verify-secureonline
  • vg13wright0r
  • vidal
  • videocolmek-bkp21
  • vv81garcia9c
  • wangdudu
  • was
  • wastelands
  • wcmmiczvxz
  • webb
  • wimqaezjiikmzoeu
  • wjto0104
  • wolfliya
  • worldwideworx
  • wqlwupa
  • writeesskrt76
  • www.ab18rodriguez0t
  • www.documentedhr1
  • www.dogg1
  • www.flavio
  • www.fotomobile
  • www.gateway365-mail
  • www.ju3of1
  • www.kecazanhu
  • www.kevina
  • www.loginportal
  • www.myvantageacct-supt
  • www.ncsecu-access-login
  • www.panel
  • www.s2
  • www.sta
  • www.toasty
  • www.wefum
  • www.willke
  • xalegutubhs
  • xoi
  • xonquiwilli1980
  • ynbm4
  • z38or6w
  • zayhcwfmnc
  • dsmip
  • verify-team
  • www.accountverify7k-secureba3j9
  • 00help-verify-citizensbank
  • freeup
  • ftp.citauthsec3uree
  • secure03-asistant
  • www.johnk
  • ftp.secure53rdbank-verify
  • bee
  • 2348apsc
  • 3099blk
  • 32
  • 4bd3rav2
  • acema
  • aiden-rz1101
  • aramid
  • arkansas-hn0801
  • backherzlo
  • bftnfuzva
  • blueguy8
  • bueiur
  • bz35hernandez2r
  • cbw
  • dalmoro
  • daniql
  • fb-kopersbescherming
  • freckles
  • ftp.atlas
  • ftp.gabrov
  • ftp.reviewdel-one
  • ftp.schwab01-verify
  • ftp.securitycheck-id01
  • ftp.suppe
  • ftp.verifycs07-secure
  • fv8ss6ta
  • fwktit
  • gavin-at3012
  • gebook
  • gethila
  • gjsesthkabj
  • gonsoherbs
  • goumai-1014.piefjhhdf
  • great
  • gtuy
  • guiysailfuucx1rl
  • haquukkeapar
  • inf0-update
  • infosce-setup390z
  • iouqkicnh
  • jasonhernandezd40w
  • jkina3oq
  • kxap
  • kxenemz
  • kyknos
  • lamondecymvi
  • lisa
  • loife1306
  • mabor
  • magi
  • memberservice-ecu
  • nach
  • nebuk
  • niflheim
  • njmm
  • oburg
  • ojrv1
  • olivia-aj1805
  • ottrekmotzter
  • oz22lopez3y
  • paola-dh1301
  • pba
  • pele
  • remy
  • secure-account-07info
  • secure07-info-verify
  • smpp
  • sts1
  • stzk
  • supervicky
  • tangthesemin1205
  • til4777
  • titronhk
  • tunnel.sdlm
  • uq1gw0gt
  • uspsredelivery
  • validate-afcu
  • value
  • vault
  • verify10b-securehost-notification
  • vianetbrasil
  • vjjtzfbbujw
  • vkujijipikifudais
  • vtdstein95
  • wellsmobile-auth03
  • writeessxjt34
  • www.agacluju1611
  • www.aladinho
  • www.baseixqarufx
  • www.blender
  • www.druginformer
  • www.help1-del-one
  • www.idotdriverlicense
  • www.mywhmcs
  • www.praise
  • www.verify-ecu-member-online03i
  • www.verify-vantage-westcu-member04l
  • wyoajyclox
  • xp86allen6c
  • yuseslij
  • zadopkezcxm
  • zhengweixubak
  • zvfp2
  • anime
  • 089795tb
  • 1420
  • 3jo79
  • 3l
  • 4oizz0ug
  • 5dd63kh5
  • amtrak
  • amvxan
  • anwarhussain
  • asruiuose
  • aubrey080212uc
  • blogkaren817
  • bordercontrol
  • bw75garcia6s
  • cajon
  • ceci
  • chanchira68171612
  • conectmaispy
  • cors
  • crossworks
  • daniel-um1301
  • dirkhome
  • drops
  • etc
  • f9
  • fantasticbarbecuecleaning
  • film.xaras2
  • fischert
  • fragilesleeveless
  • ftp.bank-secure
  • ftp.marboni
  • ftp.trendy
  • geodqtzevk
  • govv-au
  • grads
  • gxingw4
  • hacking
  • hs7ap8rk
  • infernoguidecu
  • ininon754
  • itchy
  • jhh
  • kcrv9
  • kh89hall1o
  • kmktremote
  • kovacevic
  • ku03hernandez2x
  • kundenaccounts-dkb
  • kuts
  • lh02turner4c
  • lighfurryocom
  • lily-bq1301
  • lowell
  • maail
  • mak3
  • mason-hp1501
  • maytag
  • mint35200701
  • mp68johnson0s
  • myadmin
  • ng98nelson0m
  • orabankbeninonline
  • pinnacom
  • pontual
  • portillo
  • praisenglory
  • priscilacasa1
  • py54wilson2v
  • qeuwo9ir
  • rongliang
  • ruzie
  • silverado
  • singing
  • skvarybr
  • tanleo
  • taras
  • tfortrtr
  • thohqcfx
  • tomo1
  • verficaton-mtb
  • victor
  • volcreampies
  • vpn.svt
  • vuadoithe
  • winona
  • writeessdro36
  • writeesslcz19
  • writeesspwx52
  • wsulpa2
  • www.1t84ipg
  • www.43d6jg
  • www.aqrtg
  • www.bnpparibasfortis
  • www.ciaprovinva
  • www.essaywrxkc83
  • www.frencis
  • www.greenty
  • www.infoverify02
  • www.knivesshopz
  • www.m3d-update-delta-obi
  • www.mekeri
  • www.odnox
  • www.ttm
  • www.uijuccox
  • www.verify-info01admin
  • www.warning-citi
  • www.wuxansiw
  • www.ywujrjjcrl-login3
  • ciprianlazar
  • connect-723support
  • garena-eventt-gratis-vvip-freefire
  • mystcu-org
  • serv1
  • www.noticeupdate51k-post2
  • www.verification-chase05c-securityhost
  • 1anilla.kosar
  • ambivalencia
  • arcticpdfxd
  • cegas
  • gretbutr
  • pchlanvn
  • thecccam
  • www.gw-home
  • 293388d
  • 3r2h2p7g3u
  • 5100
  • account-info
  • aybr
  • connor-nn1301
  • consultcheck
  • dlcs
  • dodgyhedgehog
  • dropboxdevdas
  • ed2jk6pb
  • energyguideke
  • ftp.mikrotikpmidlk1
  • ftp.spiderman
  • ftp.verifyecu3
  • geoffm
  • helldingcordpic
  • hitakgux
  • igtenewsciplie
  • isabella-tm1201
  • joseph-jq1401
  • josiah-lw1301
  • klonererba
  • leah-oj1201
  • lpj1103
  • mansaba
  • michelle
  • microwavestorez
  • mihoutao
  • mrld
  • nikki
  • pijjekmdun
  • pjuf2701
  • radarr.ben
  • ragkuliof
  • richey
  • rkzxnpih9x
  • seoer
  • silversealiaon
  • tausiso
  • tplj
  • uctcgpu
  • utah-kp2912
  • uyhut
  • vz376ex
  • wellington
  • word
  • wvw
  • www.accountsecurity-info
  • www.area-personale
  • www.au-gov
  • www.exostflash
  • www.gwimwz
  • www.huefredilo
  • www.normas
  • www.paypal-verifica-obbligatoria
  • www.planaltinadf
  • www.qianyuanaini
  • www.ryishmuqcv4do5m
  • www.vozaniyq
  • zmehjyzrfx
  • kenchou
  • 01010101
  • 141wm28knx
  • 1787
  • 40llup
  • 5eng681
  • aarcarr
  • accountpaypalverify
  • acmb88
  • ahrens
  • anggrekcikarang
  • apuerrtrbkeno
  • austin-yr1101
  • aww
  • axytgbcgmw
  • balacula
  • bertkryna
  • bgcs
  • blaster
  • burbank
  • ca1lsscj.haapye
  • cardioped
  • cdn.wnbh
  • cerragri
  • charliethompson
  • chubb
  • chuckworleymassage
  • cks
  • clavier
  • cmrzlvvoompgnx
  • continents
  • decals
  • ds74wilson5g
  • dvr001
  • dylan-db2901
  • ej47baker2u
  • emily-by1301
  • emp03wer
  • faith-ji1501
  • fargo032-secure
  • fern46000801
  • fiddle
  • florida-fs1101
  • fsxqtk
  • ftp.acrilicas
  • ftp.berg-gebaeudedienste
  • ftp.getdmff
  • ftp.kal
  • ftp.pvaur
  • ftp.send-cloud-88
  • ftp.swriteyyo84
  • gavin-te0801
  • gs15miller3p
  • hailey-rh1401
  • harlekn92
  • harper-zh1301
  • harris
  • hassan
  • herdon
  • hiale
  • hmleong
  • ibl
  • igor
  • indice
  • integraisp
  • irregular
  • it84allen1a
  • jasonwhitei75w
  • john-sw1401
  • josiah-ed1201
  • juja0f3ixs
  • jury
  • kb3
  • kennethclarkz15g
  • khlim
  • kimber
  • kloburgharry
  • lego
  • ls
  • lupi
  • maier
  • mail.monat
  • mail.when
  • mia-wh0901
  • minnesota-pl0603
  • moka
  • msk
  • munisd
  • noctwolf
  • oregon-sr0801
  • padonak
  • parksiespubpints
  • paulmillerp60h
  • pollux
  • provpanckopsand
  • psmlubricantes
  • puhodiarteg
  • qpme9l8
  • quenteepicante
  • redirector
  • renter
  • rwer
  • s21y
  • scripts
  • sdcumt
  • shoppinglaranjeiras
  • stahraoui
  • swriterpi97
  • talaganis
  • tapes
  • tasguivanse
  • techgear
  • tedder
  • tharin
  • thug
  • tn23allen7g
  • tuni1
  • uiebfwiubefiu
  • umtxjkvaweiw
  • uv55perez5e
  • v-casa
  • ver-mobile
  • verify-ecu-member02a
  • verifycs07-secure
  • vk26allen3q
  • vpncopenor
  • walks
  • webmail.user10ccu-3cure
  • wintermute
  • www.57309b
  • www.ao85jxuocj
  • www.biz
  • www.construserra
  • www.dyivqaerkuapjuemdootpualfxq
  • www.ecu-memberacct2
  • www.emp03wer
  • www.gf34parker5c
  • www.icjub
  • www.inprecerer
  • www.iqaammeoue
  • www.macao
  • www.mjumu0og
  • www.nexi-service-nexi
  • www.p2p
  • www.riumu5ox
  • www.schrodyr
  • www.sdn
  • www.soniv
  • www.ticketman
  • www.verification-online05b-securityhost
  • ygaya6or
  • yuen8
  • zp53scott7e
  • bceqifhixifahepn
  • hohomemedia
  • roundcube.belette
  • secure09chases
  • ukhava
  • www.hotep
  • www.shopgiangvlogchayspin
  • 1543
  • 1906
  • 3940
  • 53m7vw
  • a8ca81
  • abelite
  • atjecycto
  • bmtvqduuyqp
  • bombing
  • cantodorio
  • carlospmpa
  • castelhome
  • cnfj247140.hkr
  • couette
  • dan115streetradio
  • decmgeikaa
  • denikrouter
  • duskewtey
  • elogicnet
  • er58harris9c
  • foil
  • ftotgpeurq
  • ftp.newworldmap
  • ftp.secures07a
  • ftp.truenas
  • ftp.verify-account1g
  • fx32campbell1i
  • guwonreret
  • gyqavn
  • humangrowthsupplements
  • izxglrwj
  • jackson-oz1301
  • jacuba
  • jd8
  • jpvcampo
  • jrjcx
  • kouki
  • lhi
  • masaharu
  • matoma
  • myhomedom
  • nqdep
  • nyco3
  • phyloged
  • pk6
  • postepay-poste-italiane-verifiche-online
  • pxoanyiicxklsaiojp
  • rearviewmirror
  • rube
  • sataedu
  • schrodyr
  • shhl3
  • simply84
  • truck
  • typhlzc
  • v2ocnnoe6lr3i
  • v7ucjgoa1sj4a
  • victoria-bf2601
  • virginia100212rd
  • vsl05u72
  • vuzy007
  • warren
  • www.53verifyonline
  • www.bawegkioshi
  • www.customerserviceecu
  • www.drifter
  • www.edocos-system
  • www.hapixaxi
  • www.johnparkerv84l
  • www.lkwwbuoqrtuudq
  • www.mms
  • www.myecu-help
  • www.pubgnewlucky
  • www.solyplaya
  • www.tapamericafirst
  • www.xhdrsjdsgq
  • www.zvfp2
  • xeiru6eb
  • zltzrfmnka
  • kaisir
  • inotos
  • secure-route-in
  • 1h46
  • 2info-afcu
  • 2j24ti
  • 3p32d5w
  • 4nvo2l
  • 7q4wgp1hxx
  • 7t3d78
  • 918m3c
  • 9xqw52gb
  • ac87anderson9e
  • alaska-ob0801
  • alisa43000801
  • amaon
  • anacdi
  • arrels
  • avst
  • belasting-portaal
  • bg09tz0
  • boulytogheart2905
  • brianna-xr1001
  • brp0104
  • caiuamaringa
  • cazuyias
  • cokshnkyxq
  • dan294streetradio
  • dettol
  • downloadp7ksviaq
  • eayucalg
  • ekpb2
  • elekgonda
  • er06collins8p
  • ernst
  • ferrero
  • ff08collins9p
  • ftp.dogonin
  • ftp.ftikojzomoad
  • ftp.lk-byte
  • ftp.mods
  • ftp.rekseg-russkoe
  • ftp.send-out-31
  • ftp.stovetop
  • general
  • global
  • gruenes
  • hcc
  • heintupbalen
  • hidak-sperma
  • iepacuqe
  • inferno05boysblack
  • info-secureverify0
  • ipe-aborigine
  • j45fze
  • jarodzhou
  • k24gputri
  • kiredfes
  • kqbizqtmvs
  • lakatostuzep
  • ldqkhugovx
  • liclitorzisch
  • lodestargr
  • lothar
  • mail.appa
  • mail.comments
  • maya-tf0805
  • mc1wo8iz
  • mead
  • menara-dea
  • metaqeuedg
  • michael-mz1301
  • mim
  • mioaer
  • mischief
  • mitup
  • mpsyruboma
  • mvtxldxa
  • nas.gugelnetworks
  • nasromainb
  • ncsd
  • nexus
  • ninepnof
  • oleg
  • olivia-zx1201
  • ooxoq
  • paulosouto2
  • pferdedaten
  • photos.delreedefays
  • postepay-myaccount-aggiornamento-obbligatorio-verifid-8ca02
  • ralu69
  • rhqrklstvtyn
  • rights
  • rnvguxjmqnpuiem
  • rokeldba
  • sakr
  • sarah-kk1301
  • secure3-verify70b
  • skor
  • smartsignage
  • smegroup
  • support-team
  • swritempc42
  • swriteqyw44
  • tony
  • tyujg
  • ugijr
  • vc1-well-auau
  • verify-ais
  • vinski
  • volume
  • vpnca11
  • washtenawisd
  • webmail.hoct520
  • windtunnel
  • writeesslds39
  • www.acrib2508
  • www.akacjoofbx
  • www.avrac
  • www.bunda
  • www.del-oneaccthelp
  • www.direct-to-install045342
  • www.help01-vantagecu
  • www.koudailv
  • www.kusinara
  • www.lasxremn
  • www.mh5ki7pq
  • www.neaz1
  • www.online-ci1izen
  • www.qe68f37pk
  • www.sancet
  • www.swritechy86
  • www.swritegrx23
  • www.terraagro
  • www.xukihbepo
  • zairon
  • zkotuxcegilodeyk
  • account-07-secure
  • ftp.amaxse
  • 0584.00f07ff0a496279f
  • 243guante
  • 5h4q8uiyr
  • 80202
  • 8n5
  • ackangale
  • agcenmatherup
  • agroforte
  • arbp0502
  • archway3000
  • armour
  • avida4us
  • benki24
  • bitter
  • bogalal
  • bong
  • bruxo
  • california-ht0202
  • cf142
  • chloe-wh1601
  • christopherhilld56u
  • clima
  • cnun2744154223.hkr
  • cpcontacts.cliknow-whatsapp.00
  • criajsa
  • crockpot
  • delivery-mx-95
  • dsuqg01
  • easton-sd2602
  • eeblveespxfoiarh
  • ejmd
  • essaywrmke19
  • exxi-pharma
  • f1qjli
  • fenris92
  • ffbx2a
  • ftp.citizensbank
  • ftp.jnec201
  • ftp.ljhnosdmcj
  • ftp.nasusbuc
  • ftp.ransynchkyte
  • ftp.richardhernandezs30x
  • ftp.silvioricardosoto
  • ftp.verify-account099
  • ftp.verify-secured07acc
  • ftp.victor
  • gabriella-au1301
  • ghedugojomipazavevijiicr
  • gixlab
  • goliveira
  • greater-detective
  • gxavlfdepem
  • gyc0502
  • harper230112sy
  • holanseg
  • hooks
  • huanw
  • hyezopnomanagocf
  • johnmckay
  • jose-xg1101
  • juan-kw1401
  • kalasoxurevoiswuwear
  • kb37hall5z
  • khloe
  • kmwijsj
  • lang
  • liam-an1201
  • mathias
  • mbuaow
  • mewsf
  • moit
  • moog
  • mook23181001
  • myafcu-update
  • mzh.xhd
  • neopco
  • new-cf1301
  • north-ty1101
  • ow90allen8i
  • paulgonzalezo02b
  • piacatlata
  • playground
  • powuxeid
  • prezi
  • rockymt
  • ronaldgarciac2k9
  • rthb34
  • saturngearboxdiagram-ldk0109
  • sauce
  • sawdust
  • sbp
  • secure-login-poste-italiane
  • securej-truists
  • sfat
  • shopsrinakarin
  • smartwave
  • smudge
  • suppt-del-0ne
  • sushanth
  • swagvilraworl
  • swriterxt02
  • syren
  • tabtirodi
  • tanugiban
  • thfuo3iemhk5oe
  • thisli
  • thomascaxias
  • tinglavicom
  • trannguyenhan12
  • tshoy23
  • tv4gsfv81kk6xkxorll5psu8bbxsrb
  • tyrlawatchdi1811
  • usps-redelivery
  • v01siz
  • vehel
  • verify0b9-secure
  • w17osnnpkhk
  • webdisk.cliknow-whatsapp.00
  • wedge
  • william-ps0801
  • writeesswar85
  • www.autoface
  • www.cheuky
  • www.dutch
  • www.g183pf2
  • www.haram1
  • www.info-secure07-verify
  • www.jinir
  • www.marboni
  • www.middle-rehost0534b
  • www.moaffgzt
  • www.online-banking-secure
  • www.pulford
  • www.rbfculogins
  • www.reswiyzqhgxuzdqkppivecn
  • www.s3cur3-1nfo
  • www.swlsspass-support2
  • www.tdbank03secures
  • www.tyler
  • www.v3-amazon-order
  • www.vantagewest-cntctasst
  • www.verify-account109
  • www.verifymtbaccess
  • www.villa
  • www.wellsfargom0bile
  • www.zmehjyzrfx
  • ztubu6ip
  • zxh
  • 6a0674m
  • address
  • alexandre
  • anziane
  • ashkum
  • battlekala
  • bes0104
  • brayden-rk1301
  • christopherdavisk32s
  • citizens00-verify
  • commerce
  • dcoffeetanbinh
  • delray
  • dichvuright
  • dikacxog
  • diroy
  • drm
  • emma070412dr
  • ferrari
  • ftp.chse01authenticverif
  • ftp.citi-support
  • ftp.ct30lewis0p
  • ftp.nnscgdeuas
  • ftp.pagopoieio
  • ftp.sidecut
  • getmanoba
  • gtc
  • gw
  • hluntungan
  • hpi
  • insidenet
  • ivanyin
  • jackson-ym1001
  • jeel
  • jesus-mg1501
  • john-vu1401
  • jpdec
  • kaliska106
  • kalista
  • kf75moore4l
  • letv
  • mail.organize
  • mkwrtoozs
  • mlp
  • motd
  • muny
  • nancy350
  • noheh
  • now
  • pesanggrahan
  • qlxgl
  • qqciwunacrfbjjmi
  • reason
  • riamakapsey
  • rinsed-clean
  • rpizilf
  • safetyciti-zen
  • secure-01c
  • secureredirectaccountcitisignon
  • smartfuseboxdiagrams-tcr0109
  • stream
  • subcucngon
  • suntao
  • swritekil14
  • swritenov07
  • swriteoqh51
  • syntech
  • texts
  • tranhoangduy
  • tsker
  • verify-vangae
  • vplogm
  • vzpk2702
  • whiterose
  • www.c0nfirmverifyauthe
  • www.claimdm-event19
  • www.finzel-lahm
  • www.kuniqris
  • www.marlene
  • www.peace
  • www.praew01182112
  • www.raphael
  • www.skyrocket
  • www.toe
  • www.verifyx302-secure
  • www.wellsfarg0-m0bilesecured
  • x7onr1
  • xgyjkgtayufja
  • zzb
  • ctzn
  • dichvucoder
  • donino
  • filmesonline
  • japan1029
  • jenkins.belette
  • toyzzs004
  • veri7y-c7a5e
  • webmail.acu1-digit1
  • winnercccam
  • www.helps01-srp
  • 2007-ford-expedition-interior-fuse-box0908
  • 3iyojn2s
  • 80012
  • 9i037
  • addison-vg0901
  • admin.alexserver
  • affairs
  • alka2508
  • ancora
  • andrew-wj1101
  • andy065432546.hkr
  • anhbkkbr
  • anthony-uo1101
  • author-citizen-host026785439a
  • avec
  • awesome
  • azteca
  • bakery
  • birthmur0507
  • bones
  • branch680015.fairstone
  • caring
  • carlos-pg0703
  • cescosallant
  • christopher-eo1301
  • chronattasy
  • chyl162-1.dynamicvpn
  • cj7wx1ev
  • clasodob
  • cloud9.potay
  • covxm
  • cvrky
  • cvvxme
  • dan196streetradio
  • darkartgallery
  • dc55williams3v
  • dga
  • diagoras
  • dinilu
  • drama
  • dw13parker4u
  • eenv
  • essaywrcse47
  • exglgglycaqf
  • ezpass
  • faiqe5iw
  • fd12rodriguez4s
  • film-youtubec
  • ftp.1000kuhon
  • ftp.kiredfes
  • ftp.stamp
  • ftp.wellsmobile-secure
  • galluvet
  • gaudin
  • gvejobe
  • homeh
  • hootodelon
  • ironegucinumimu
  • isaiah-gg0801
  • iuavcuoczauosmea
  • jayze
  • jerman
  • jfmxjk
  • jgz
  • jixqozoufe
  • kh94king6a
  • kipiaycpn
  • klohgoknvt
  • kns2.remlex
  • ld87sieanq
  • lkp
  • ma3
  • madison-de1201
  • madison-lg1301
  • manufacturerandtrusts
  • me5nq5tj
  • mibarra
  • montserrat
  • mtbank-lockedww3
  • mypublicoath
  • nerolac
  • new7usasipsb4er
  • nicholas-zd1001
  • nj80king9t
  • nnet
  • nrp2802
  • og-kt-umdpro
  • olimpoo
  • ombuxumvlzyzmsksu
  • oxtalesuk
  • paubuzzpowmii
  • penmoliker
  • ptc.xyz
  • qtdphula
  • quickreclaimed247com
  • refuge
  • ruahnet
  • russian
  • s8ezme4r4aj
  • sacugavoirrii
  • sgh
  • sktao
  • smallshopoo
  • stefschwartz
  • stet
  • stith
  • suwal
  • swing
  • swriteroh13
  • swriteryi75
  • swriteslu05
  • terganpluting
  • til36103
  • timely
  • toby
  • ttjer
  • ucyl4hw
  • umiefu
  • ux28lewis6n
  • verify-del-1onefcu-user
  • web-bancoposta
  • worldrescue
  • writeessapc34
  • www.account-security-info
  • www.ads
  • www.cu33miller1o
  • www.h7ecnui
  • www.heloisapenna
  • www.ijohn7fh
  • www.laborderie
  • www.mobilelegends-rdz
  • www.moxodulo
  • www.plxoehbeigcae
  • www.s09t-online01d-02ath
  • www.sarastensbyme
  • www.sayuti
  • www.secure00-citizensbnk-auth
  • www.sliver
  • www.ucyl4hw
  • www.verifysi07b-securem
  • www.z8v95
  • wyatt-di0703
  • xygw
  • yomqcbviqkz
  • youngmedia
  • z8v95
  • zhukajpeuofuiaxn
  • 12broadmead
  • 5njww
  • 5uh80
  • 83qrm8
  • aakizcet
  • afculogin-rv
  • assa
  • baingana
  • but0502
  • caleiro
  • chloe-yj1101
  • cline
  • cyegitaj5eb
  • dzukenkodebu.novot
  • essaywrzni43
  • ethan-ud2703
  • fifv1403
  • flacos
  • freenet
  • ftp.lomneoconsra
  • ftp.sardiospirsi
  • ftp.secure03a-chasecom
  • ftp.securephpredirectcitionline01
  • gnc42i
  • guapo11
  • guava
  • handler
  • hunter-kx1503
  • jasonnelsonr02d
  • jqadmcmuctt
  • kaylahdesigns
  • kocmoc
  • luis-ss0703
  • mail.elizabeth
  • marketcentres
  • molombo
  • mutu
  • n
  • nokair
  • notified
  • oyek
  • oyhhawihg
  • pedekmuz
  • polarspace
  • progressive
  • qesitewoaa
  • rnbiymh
  • sabnzbd.lleon596
  • ssgc
  • swritefyp85
  • trefdiuko
  • unbearsey
  • vatenhype
  • wallpaper
  • webmail.group.scrlm.nara.esports.00
  • wezbyjprvc
  • withd.vzlo
  • writeessajd68
  • writeessgtt42
  • www.acct4support-ecu
  • www.csp
  • www.fidelity-investments
  • www.globo
  • www.kejefrit
  • www.wdidtaleazquovqaumc
  • x70nnnv7
  • zoey-nv0801
  • strangerthings
  • 2seu2l
  • 3808y1q
  • 7fvvaj3
  • amine
  • arizona-pw1301
  • balder
  • demi
  • duncanyu
  • essaywrkix54
  • essaywrqjb38
  • fpeqo1am
  • frauen
  • genjuroho
  • media.oakington
  • qiofa4ek
  • sentureta
  • shipping
  • www.fxnac
  • ytypab
  • australiataxauoffice
  • munchen
  • secur07auth1nf0
  • ftp.mossotto
  • reactfe
  • ys100-dl
  • 0upbi6
  • 1457
  • 3rkdf4
  • 4h8h
  • 7thsky
  • 9aovgq7t1n
  • adobe
  • ahmedabad
  • alkaline-hold
  • aoxaheip
  • arizona080112pb
  • at17thompson1c
  • aubouju
  • auth-del-onehlp
  • auth-ecu
  • bancoposta-mypostepay-web
  • bankovi
  • beetles
  • bericht
  • bfopwaesjplaeixh
  • bizdeal
  • bntutvaesmjtz
  • borbaz
  • bv
  • callender
  • candy
  • castor
  • cbmcomaha
  • ceara
  • cgm8899
  • chess
  • chhernandezs9m
  • chosse1
  • cityshop
  • cloud.lu6fer
  • cltizensbank
  • dalajitey
  • damjanic
  • devil8899
  • dion
  • donaldmartinm04c
  • ductho36b
  • dwdw
  • e366q3
  • earnest
  • ebtszerviz
  • ecovision
  • edwardyoungs02g
  • essaysoixhgtnq
  • esx60yu
  • evelyn-mu1101
  • feines
  • fenupuh
  • flatmike
  • ftp.4ic14j6
  • ftp.authenticatec88-secure
  • ftp.carlos
  • ftp.castle
  • ftp.ncb-trans
  • ftp.palmeiras
  • ftp.terhajno
  • ftp.w3sfg0updt
  • gf3zm9af
  • google.shawmyac
  • grafi
  • groofy
  • gundol
  • healthbeautywellbeing
  • heathyn-dump.falsstan79quiverbabb
  • hecklerkoch
  • heklgau
  • hk4i91
  • hurtigruten
  • huyaswas
  • ij9tt2hl
  • iloveoov
  • im2
  • imap.angusnoach
  • info-secure07-account
  • into
  • irongroup
  • jack-qm1001
  • jennifer7700
  • jjhfah
  • jose-dn1201
  • jqfp1
  • juan-ct0801
  • kamila-fq1101
  • koyeb3-1014.ojfjrihgr
  • kramatjaya
  • krieger
  • lagecacon
  • landon-oo1101
  • landslide
  • lb001
  • lekurzlodu
  • lhali8ux
  • lirenkovs
  • loiujterbooks
  • luatennh
  • luyut
  • mail.formalwin
  • mail.user
  • marsolnet
  • masjid
  • maxfitness
  • mburer1106
  • mgacom
  • minors
  • mkt2534293.michonne
  • monge
  • mowqigircx
  • mpdgwq
  • mpqzqd
  • muji
  • myddns
  • ncsecu-bank-mobileapp-help
  • ncsecu-org-mobileapp-help
  • ncsecu-org-support
  • nkwifi1
  • north-cr1101
  • north-ot1301
  • nsecuuu1
  • nytrnvnpxtkmcdu
  • nzfyoo
  • oec7012
  • oeisi
  • oszii
  • oupuxwep
  • pastusiak
  • pkmedia
  • prodigyguidevx
  • psychsourfivet
  • pzpr
  • qplqctvq
  • qro
  • rate
  • rbx2
  • redbull
  • resonadorlincoln
  • rkhome
  • romnn
  • rrlangames
  • rtk
  • sanna
  • sbfqc26
  • seahawks
  • serra
  • serum
  • sevaron
  • sip.sparto
  • smp3salatiga
  • softbox
  • sourceconnect
  • sourcepallasoo
  • sqv0802
  • suo0dbmpt
  • suppgotantra
  • support5rd-acc
  • swritehqg61
  • swriteiny73
  • swritenjf07
  • tastviczkedders
  • tegel0507
  • thce-vpn
  • tqbtgzbtxf
  • ubqrn50
  • uganda
  • uk74white3z
  • uncano
  • updatespostep
  • uspostonline-track
  • v4e141
  • va1
  • verifycah-secure01
  • vince
  • wdr
  • wearnay
  • well-xd1-verifiay
  • wsystem
  • wtologdtqk
  • www.2til51
  • www.ambivalencia
  • www.aobrsbuksl
  • www.appsilsos-gov
  • www.aqirstaral
  • www.butter
  • www.carte-vitale
  • www.ccddplo
  • www.chas3-secur3
  • www.cibuburcountrysoft
  • www.congraguihysri
  • www.cx58roberts8d
  • www.davidkinge38e
  • www.dk35baker0c
  • www.gufipohy
  • www.imre
  • www.kolonyevi
  • www.noctwolf
  • www.paefamisys1811
  • www.pancake
  • www.propac
  • www.rings
  • www.s2b01
  • www.scobnafordai1971
  • www.season13ucskin
  • www.secure-server33
  • www.secure-verifications0b
  • www.smtp365-secure
  • www.uaprgnqaefwsiv
  • www.vantagewest-care3
  • www.verify-vantage-westcu-member06l
  • www.verifyab03-securem
  • www.vvyat
  • www.y1bh3
  • x6o1mirbeo
  • zaja-minet
  • ftp.sm31wilson1d
  • peixe
  • cs5.parsan
  • demosc-freefire
  • exjpnozjmyg
  • photo.rpiathome
  • stepsnet
  • www.nosmo
  • www.taoshopgame1s
  • shvb2203
  • 39pof01
  • ae35lopez1a
  • ethylene
  • eu3
  • f85ar6i
  • fffoowteiyqia
  • ftp.help-ecu0
  • ftp.pino
  • granab1006
  • gwdkcucswu
  • higher
  • hinet
  • impala
  • jddumaplgj
  • l0azko1x3ug
  • lde0111
  • marosvasarhelyi
  • mori
  • n63770f
  • nesplu
  • oencs3oqkd9xe
  • qb.4andr5
  • schooool
  • secured-onlineupdate02
  • sinaras
  • sinco
  • special
  • swritetid45
  • swwwong
  • thecincidaddy
  • valeria
  • verify-ecu-online-memberi2
  • verify841-secure
  • www.cohepnus
  • www.ecuaccount-care4
  • www.excelfile-z4
  • www.focgjrfbc
  • www.hafoki
  • www.wells0farg
  • www.wvw
  • ylqaycdszw
  • yutsvbdxega
  • zsj4d
  • 06j4xf
  • 1250
  • 1pauruduckfea.kosar
  • 3112s3780w
  • 35019d5n
  • 9of4735
  • activehours
  • alialaqel2017
  • angel-pu1301
  • annaik
  • anode
  • ap78jackson3c
  • api
  • arrowhead05c
  • automobile
  • becu
  • bpiweb0nlinesavingph
  • bqoke7ag
  • branch650023.fairstone
  • bridezilla
  • bsffvxx
  • butternaly
  • ced
  • chairsz
  • colorado-dc1001
  • comkids92ep
  • cpanel.userverify03
  • crispin
  • czrhrqeg
  • darbeau
  • devedelarsi
  • devsan
  • dg34
  • diego-gh1301
  • dole
  • domstation
  • echrhj
  • eco
  • elsy
  • emissions
  • esoh1006
  • essaywrbsx39
  • essaywriry62
  • f4154e
  • fd
  • fenster
  • florals
  • frzsm
  • ftp.ananas
  • ftp.bilverdy
  • ftp.duralute
  • ftp.fracdisridug0905
  • ftp.hub-in
  • ftp.jeffcollinsh21j
  • ftp.oq89phillips4h
  • ftp.scale
  • funny
  • gateway365-out
  • gavin-pb2606
  • geef
  • geekholdings
  • gems99
  • giuhydleiga
  • glasskote
  • glory-server
  • hd3mv3en
  • hear
  • hexbin
  • hwc
  • hx53martin5u
  • iaii
  • iclickmed
  • ik1shj
  • informatica
  • jabber
  • jcfxrpdbtohpr
  • jellyfin
  • jisb2702
  • josiah-fd1301
  • ksoo
  • lazland
  • lesbruyeres
  • levels
  • lizard
  • lv426
  • macquarie1
  • mail.trendy
  • mataku
  • mhztvbawfnj0so
  • mia-cv1501
  • michigan-cp1501
  • mobichur
  • mrmh
  • n03.gm-n
  • nettfor95
  • netzego
  • nicole-dj1301
  • nk54baker6b
  • obolaziyer
  • okefi1uv
  • oryx
  • packaging
  • persia
  • pesto
  • philippine
  • plasti
  • preethi
  • ptt.gov.tr.xrnz
  • puerto-fd0801
  • pwmag30
  • redstar
  • richardleer04j
  • rinok
  • riofircompber
  • safety
  • safszncrndfvmg
  • scheibel
  • server202
  • shpil
  • smallz
  • speedevsabutgabb
  • ssv
  • ssvonline
  • supsantaizabel
  • swiss
  • swritealf18
  • swritejph61
  • sylarte
  • taiga
  • taj-density
  • tbk00lsx
  • tease
  • thoni
  • twasol
  • vfwjlpxp
  • weald
  • whereswally
  • writeessisw78
  • www.086a05k
  • www.16i245
  • www.3t4vid5
  • www.7a7f2d0b4e
  • www.adsose
  • www.api-mid-transfer
  • www.apr-citizens-sec02
  • www.b573l
  • www.bimpa
  • www.cnt
  • www.dan35
  • www.gadvopzeim
  • www.kdc-athome
  • www.marius
  • www.pfeiffer
  • www.qruikvafafuo
  • www.sparker
  • www.testador0001.arquivo4453
  • www.ty13white4x
  • www.verification-secure12b
  • yaomquagmooes5dh
  • yhn42a
  • ytuug
  • za54rodriguez5r
  • zby
  • znas1
  • zqlbqwqrf
  • zvsxrufyrt
  • zvvtpttyal
  • aws-update
  • engelarsrv.alia
  • eventlucky-spinterbaru2020
  • hbi
  • macfeeupdate
  • mid-hosting052
  • www.ipinfos
  • www.middle-host-trans
  • www.mystcu-org
  • www.toyy001
  • zakantuni
  • arrysdu
  • fabgro
  • focgjrfbc
  • milsaltcumpgos
  • nspirit
  • rfwsvohr
  • satb
  • sph
  • totolink
  • www.33278mt
  • www.kettprovbatis
  • www.protenchemar
  • www.secure1-vantagecu
  • 0iw4tc
  • 1038
  • 1opesproj.kosar
  • 1riue7
  • 65j53r
  • 9698
  • afcuweb3
  • alfredo
  • andreia
  • anox1006
  • baru
  • bi3
  • biggie
  • blyb
  • brandi
  • bunting
  • catablu
  • chaiyo-nb
  • combes
  • cpanel.limited-webserv
  • ctn
  • curtis
  • dan8
  • dareizlnicateobucatea
  • del-one-fcu-assisthelp01
  • diw5a0jibz
  • dsns
  • dxkbwkqlyo9fv8s
  • emily
  • emo
  • essaywrdia32
  • essaywrsxx37
  • essaywrxxy01
  • essaywrzns94
  • f6v1ejp
  • fai22171001
  • faith-pb2901
  • fcgw712
  • ftp.alefmk
  • ftp.authcontent-sec03
  • ftp.chaseonline
  • ftp.verifycom03-secure
  • gasfrrwilokx
  • gikgjures
  • gsbaukxoeseyanope
  • guidehorizonzi
  • guoallstarkvargr
  • gy87taylor8u
  • hangtimewne
  • hannah-tx1601
  • hauptmann
  • helpchase1
  • hipuner
  • huunuu
  • ibrahim
  • isaac-eb2003
  • izlj2701
  • jasonwilliamst38n
  • kingnet
  • kolak
  • kolibriecloud
  • koralez
  • kqhervmry
  • lbx
  • lman
  • lqwufrhdf
  • lucy-kl1301
  • m2ghz
  • mail.groupwhtsappbokp.00
  • manolo
  • mercadao
  • merlinsurabaya
  • metto
  • mirror
  • myblogadams165
  • napigupduzeflw
  • netstart
  • nirancofu
  • np08carter0k
  • nwidxuyeq
  • ojfwiveywo
  • olds
  • ouxexieq
  • ovoro
  • panosru
  • paola-pm0901
  • pd
  • pest
  • posen
  • postepay-myposte-verificaveloceonline
  • potrek
  • praewa94050701
  • pregame
  • pulitzer
  • pzyep
  • qayiycuy
  • ra53carter2r
  • rbg
  • renoveac
  • rewosj
  • rocheban
  • s0ozri9s
  • saturnswitchmap-zrt0109
  • scmoss
  • sgmmck
  • sii
  • siqueiranet
  • sophia-cf1501
  • spater0307
  • statistical
  • strychnine
  • t0mas
  • tanggy
  • treinar
  • treshchalin
  • uecouqvxfk5is9c
  • vasconcelos
  • verifiche-online-bancoposta
  • verify-53autha1net
  • verifysecures05
  • vial
  • wcori
  • wellsfargoaccess
  • whfc
  • writeessdmr89
  • writeessgzb80
  • www.442862f
  • www.bxhgie
  • www.cartasi-spa-aggiornamento-necessario
  • www.customerhelp-2ecu
  • www.cvzfdouivj
  • www.fargo79-secure
  • www.fr
  • www.jxasujqueuvuyarp
  • www.lastalarmclub
  • www.myvm6wt81z2k
  • www.qq
  • www.secureip003logins
  • www.stg
  • www.swritejua85
  • www.teamontrack93
  • www.validate-53ccsernet
  • xfxoprjpik
  • xg59harris6e
  • xinye
  • xoboku
  • ypopov
  • zbzkm
  • zmsf2702
  • zoey-fk1601
  • zoodles
  • 1authenticationupdate
  • 1paslogot.kosar
  • abfab1306
  • adrian-py1301
  • appleadaystudio
  • bc12davis1n
  • brianhallg83s
  • brooklyn-tt2912
  • checkscamer
  • clutunpodli
  • cpanel.kbit-host.00
  • domgoss
  • educators-help
  • egancarmi
  • fortnite
  • ftp.comra1106
  • ftp.navyfedera-m0bile-verify
  • ftp.postmaster-in
  • ftp.xy89rodriguez1f
  • haines
  • henry-pc1001
  • historia
  • hjuaiydenolayett
  • ilff8
  • ininclotvey
  • international
  • interpreting-5870
  • journalism
  • muamanguon
  • neysparor
  • nihad
  • nordlead3
  • onix2
  • pielicejor
  • polalopi0805
  • prom
  • prottafoxrigh
  • prueba01
  • racunar
  • ryac
  • sandy1f
  • scandal-2215
  • secure-verify02g
  • skull
  • slidernet
  • soukaina
  • tephix
  • ttape
  • verify-citizens-online-user1
  • writeessroq62
  • www.77n10rc
  • www.autebvaj
  • www.security-update-secure
  • www.update-security-info
  • www.verifysecures05
  • www.writeessyof88
  • help-securecitizenbank
  • meromorphic
  • security-verification
  • engelsrv.alia
  • ncsecu-mobileapp
  • um2.serv1
  • 8m163
  • datamc
  • freetv
  • friks23
  • ftp.huyaswas
  • garena-event
  • gibrary
  • handle
  • kamila-za1301
  • mario
  • mimimomo
  • mycg
  • new-ln1101
  • reeves
  • supermercadosuperserra
  • swritehix36
  • teamsfalklosadi
  • tv95thomas0o
  • virginia-oe1001
  • www.areamanager
  • makayla-lz1201
  • 073x0871893x
  • 1t84ipg
  • 2de
  • 6175
  • 7ukgm7ep
  • 929
  • abigail-lx1401
  • alefmk
  • aleraf
  • alwkxetwwfhpd
  • apk09-data-hoster
  • aqeyca
  • astralis
  • aswebnetwifi
  • aulyaztxap
  • auth-srp
  • bancopostaclick-aggiornamenti
  • bpilysavinuniphserver
  • bpkzaxwtjmov
  • branch690027.fairstone
  • brianrobinsona09f
  • bruce
  • burefdtef
  • busudaxqeb
  • callaway-belconnen
  • cans
  • chalys
  • coloreti
  • connor-bc1101
  • daisiturtcon
  • daleys
  • dash
  • datalust.benfl3713
  • diego-yg0202
  • djtc
  • doncorleone
  • dupre
  • dylan-sa2602
  • ecu-userdns4
  • ecuaccount-care4
  • ejxvyrfgqkr
  • elijah-ks1401
  • emmmymupwj
  • emw
  • erdosenda
  • essaywrmcw11
  • essaywrndg81
  • essaywrwsa64
  • evqbtjqktivvq
  • f5s51
  • fabiope
  • fear
  • ficakonwinf
  • fict10n
  • files21771
  • finazen
  • flip2.anjay
  • frank123
  • free-skin-epick
  • ftp.7fvvaj3
  • ftp.bc12davis1n
  • ftp.foagkindl
  • ftp.gb89mitchell2t
  • ftp.lighten
  • ftp.retrospacerandco
  • funserver
  • gabriela-gu1401
  • gfeqanb
  • giants
  • guidequotelt
  • hacker
  • haviet
  • hilo
  • hiring
  • hlibodar
  • ibavocam
  • ifadli
  • isaiah-zd2202
  • iz97turner6m
  • jack-ug1301
  • jasonwrightl94w
  • jayhawk
  • jeezaxyne
  • jnane
  • jose-wi0605
  • joymifoods
  • kevin-ln1101
  • kulgarberbagi
  • lamakito
  • linkralna
  • lively
  • lma
  • lorence
  • mecolakw
  • misa-apartment
  • morpheus
  • msginindia
  • nameserver2
  • nana
  • nathan-wq0901
  • nery
  • nfcu-secured
  • nicholas-bv0801
  • ninglipxeja
  • norweb
  • nvidia
  • oklahoma-rc2002
  • onkovko
  • pamk
  • pclassic
  • perry
  • pink-fox-model.bide97
  • praise
  • punjab
  • qcfaknbxmu
  • qxulhs24
  • reportdfs
  • rorack
  • rrx
  • seba
  • secure-hub-out
  • secure00-citizensbnk-auth
  • secure07authbank
  • securelogin01
  • server-verify01d
  • sevens
  • shepard
  • shopnick
  • shoppkhai97
  • skatevopcrawin
  • sosaudewebserver
  • studiopinguimkronus
  • swriteadt81
  • swritedrx84
  • swriteeuh69
  • swritegqk41
  • system
  • teledyne.applecs
  • terhajno
  • tore1108
  • totalp
  • tufgjzflgfeviy
  • tvise1im
  • ubrmk
  • um13turner4j
  • unique
  • us2.gotothere
  • verifyx302-secure
  • vps-dedi.hard
  • wgwempgwzv
  • william-yi1301
  • withdraw
  • worst
  • writeessqms45
  • wtlbcxkfsfg1311
  • wuxloatidehoxoj
  • www.1nf0s3cure
  • www.abedomo
  • www.account-07info-verify
  • www.aptk24vienna
  • www.ben
  • www.cerberos
  • www.cilangkap
  • www.coskingtorjugg
  • www.dayoftomorrow
  • www.del-onefcureview
  • www.essaywrcne99
  • www.ethan-jz0203
  • www.fishinglurers
  • www.helpcontact-ecu
  • www.hgiyc8u
  • www.hunt-tingt00n
  • www.israel
  • www.jjpetro
  • www.likged
  • www.nnoocpoearj
  • www.omnes
  • www.oqktah
  • www.pamukkale
  • www.ruzinov
  • www.secure-verifications5b
  • www.securinfowells
  • www.skull
  • www.txveri1fy-ser09a
  • www.verificheinformazioniposte
  • www.vixluuqnoarbxuew
  • www.watchesshq
  • www.wattnaluheel
  • xizicoqg
  • yrenatraganekixs
  • 06
  • 4771qg3g5
  • allison-tz1401
  • altanettelecom
  • ctc2.heai
  • dgs-treasure
  • fangnenaro
  • fmk0402
  • ftp.jatibening
  • gx1ih
  • huzei2yqcwi2lo
  • largo
  • li46thomas5f
  • lineertza
  • maybe
  • moa-gp
  • omropfryslan
  • pafnu
  • promobycarue
  • qnofljdzcisxr
  • stelmepo
  • swriteqph51
  • tedx
  • uvxmhtth
  • www.actedupdted
  • www.essaywravy97
  • www.verify-security12f
  • www.secureconnection30b-chase-verify
  • ftp.3secqu3eauth
  • veruugfgh
  • www.citi-verify007
  • www.mt7se3ba0uthefsjsp
  • www.secureconfirm5k-loginciti6r4
  • principal
  • 5f9d9r1p
  • 6w40ekn
  • 72
  • abiandy
  • abinimdig
  • agorism
  • aiden-ps0801
  • akhrot
  • akinita
  • alquimia
  • alwayss
  • ancel
  • andradeinfo
  • andrieso
  • aquaguidewk
  • archea
  • au.biggg
  • authyour-srp
  • ava-dg1501
  • bb-systeme
  • beethoven
  • bentley-hi1301
  • beststory
  • birmingham
  • bkk-home
  • bn89lopez8j
  • bodbod
  • c1ico87p4
  • cb140v
  • ccua5567
  • ch93adams1o
  • cijoyujpop
  • ctr
  • dan47
  • darkwars
  • delaware-qd0801
  • delgrollothbook
  • dentuman
  • doors
  • ebtest
  • ec83martin6k
  • essaywrdln97
  • eyocafe
  • farmingscout
  • fengsheng
  • ffnmt
  • flux
  • ftp.abedomo
  • ftp.jowa5xir
  • ftp.loginwellsfargo
  • ftp.luive6ov
  • ftp.mcp
  • ftp.rakovec
  • ftp.rkcarcbudo
  • ftp.secure-redirect
  • ftp.verify-secureonline
  • ftp.verify-srpcu-member08
  • ftp.xa-chas3-validation
  • ftp.zafugburi
  • gabriella-mt1201
  • gavin-dl2402
  • georgewalkerx45i
  • gjqqx
  • grat.soro
  • grjcbk
  • hdgvqzojrr8ed0y
  • healthy
  • hexa
  • hltpgifha
  • hmembr
  • homevt
  • housecleaningmaryland
  • hxnh8
  • idaho-lw1401
  • ikbkip
  • ingvarr
  • inslbrefro
  • instant-online
  • ipcs
  • jackson-tc1401
  • jacob-ed0101
  • john-sl1401
  • josephhillp47t
  • julia-jj1201
  • jzmxkvtrbhy
  • k16.gm-k
  • kaciid
  • kenczkwmlk
  • khanhrobloxvng
  • lafofi761
  • latbeta
  • leah-hz0901
  • legion
  • liseli-kzlar-ifsa.posri9sendtetend
  • llz
  • loli
  • maguro
  • mail.butch
  • mail.comics
  • makeliveseasier
  • matthew-hu1101
  • mbofunepifuhejenamegaovp
  • megapopular
  • melzc
  • mia-ah2003
  • mississippi-ab2702
  • mouth
  • na5xzv2
  • na74evans4g
  • nan17103001
  • netflix-secured-03xa
  • nevada-yg1401
  • nhbpci
  • noscon
  • odds
  • online-platform
  • ophlobottdob
  • parys
  • peoria
  • pepukal
  • picataws
  • pneumadyne
  • pnuehcjdaeetrey
  • portbou
  • postepay-myposte-id-aggiornamento-010248
  • poverty
  • ppw
  • printburo
  • px51robinson8m
  • qdn0104
  • randa
  • reach
  • rocha
  • romantis
  • ruskiii
  • secure02g-chase
  • skatsubo
  • spada
  • spid-poste-id
  • stickers
  • svetlanaz
  • svrh
  • swritebbm89
  • swritenao73
  • timwi
  • tinquidorlink
  • tk86white7p
  • tyklop
  • undo1306
  • uraamcqc
  • uzz8788
  • verification-chase023b-securityhost
  • verify-vantage-westcu-user07
  • vernacular
  • wod
  • writeessquv51
  • writeessqyu25
  • www.acai
  • www.bz2qz9p
  • www.citizenbankonline
  • www.cooolwebeur
  • www.csh
  • www.ecu-member-policy01
  • www.everwin
  • www.glory-server
  • www.hbjsuf
  • www.john8472j
  • www.khattabah
  • www.labvirgenloreto
  • www.lexx13
  • www.loydaneder
  • www.maxlan
  • www.mycofidis-portal
  • www.peterdesk
  • www.pldt
  • www.telephotostorez
  • www.trepot
  • www.verify035uset-secure
  • www.wyieo5a7suvvi
  • www.zeroen
  • www.zonlicht
  • www.zzzmvua
  • ym90baker6t
  • yrigte
  • ywujrjjcrl-login3
  • zcoxoes
  • zqudo2eg
  • zy9udfxgw7rz
  • ajazg
  • ap
  • fishinglurers
  • ftp.restoreaces
  • novaprime
  • oezoqtout
  • pynchore
  • suburban
  • sweropx
  • www.lijigbub
  • freedomfiles
  • secure-account07-info
  • webmail.frostbank-secure
  • www.levelauth59j-alter2set
  • www.mt7ta0uthsec3ue01b0ank
  • 1anipames.kosar
  • 2009
  • 4blgb2xn
  • 5u7n3s
  • 8x98imu
  • a5k89vs
  • aaliyah-db1201
  • ab
  • ailati
  • almarketmedia
  • alyazidy2016
  • amit
  • assi
  • ax70hill6l
  • azun2507
  • backburef
  • bboxm6
  • benjamin-mu1501
  • bpmmodules
  • branch600601.fairstone
  • branch640715.fairstone
  • branch660025.fairstone
  • brasiltec
  • bushnet
  • bytes
  • cagov
  • campogrande
  • carlos-hg1401
  • comto
  • contorno
  • cthree
  • dan57streetradio
  • dichvucodefree
  • edgar
  • eine
  • elrsjeyihsfe
  • essaywrali40
  • ethan-jz0203
  • fabiobeoni
  • faxes
  • fejitjezv
  • filial40
  • fockehk
  • freerunner
  • friedlmi
  • ftp.661we8
  • ftp.alerfifth3rd
  • ftp.dialcom
  • ftp.gdjhi
  • ftp.jimbobrocks
  • ftp.kre-nas1
  • ftp.relay-delivery
  • ftp.verify2login1m
  • genialveiculos
  • gerwqas
  • haitran
  • haxzz
  • hgvymcy0xrtq8e
  • htvucqn
  • jp1.mikeslab
  • kamila-xt0901
  • karp
  • kjxap
  • kranebnes
  • ksshkola
  • lawguys
  • limak
  • linknet
  • localdisturbance
  • lstech
  • lsy54ew18
  • massachusetts-yq1301
  • max.pgm.silentium
  • mokol
  • ne
  • nerssinvedi.fenikos
  • news
  • nick
  • nmapa6ex
  • nuvipuweye9w
  • nzr2794
  • oliver
  • ovelidry
  • padre
  • paul
  • produccionesasfalticas
  • px95carter0v
  • raeqdo
  • renascer
  • robertedwardsy94f
  • rrbbs
  • rrc
  • ruchi
  • s32xls
  • sauroakcpea
  • sebastian-fc1401
  • sec4cltl-auth
  • secure-aolmail
  • secureo00-accountuser
  • senkal
  • sigma-server1
  • signin08z-authenticatedata
  • sm31wilson1d
  • stevenmillert78t
  • sumanta
  • syracuse
  • tbc
  • ufcsmartvan
  • user-americafirstlogin
  • verifyc90s-secure
  • vndehodeovs6fp
  • wblr
  • west-gg1001
  • wishnet
  • www.1k8u22k
  • www.accountsecure-infoverify
  • www.bilog-vdi-04
  • www.edfoundation
  • www.evan-sd1101
  • www.filial09
  • www.flexcloud
  • www.henatimgex
  • www.menara-dea
  • www.moe
  • www.podemos
  • www.projectq
  • www.ruqorenite4m
  • www.secure-01b
  • www.songtubby
  • www.srvuk
  • www.xufomipafixuesas
  • www.yby
  • wyieo5a7suvvi
  • xy89rodriguez1f
  • y4y93z4
  • yahoo-sigin-tw-sharing
  • yfigigiiguy
  • yt75hall2j
  • yutst
  • yutucic
  • ze0xxleuur
  • zlfbwsq
  • 1205
  • 20th
  • acfervostflam
  • acfitiro
  • andrea-en1301
  • bsbweb
  • chrisj
  • citizen-mobi-host0521b
  • cleosprings
  • clockworkinc
  • cocks
  • conduit
  • containers
  • delaware-on1101
  • dgvawefx
  • disrugotre
  • dmais
  • egjhmluipu
  • eighteen
  • elete
  • eyilmaz
  • ftp.lowlights
  • ftp.placeiberville
  • ftp.secureconnection02-wellsfargo-verify
  • ftp.supavoxietwii
  • ftp.test-school1
  • ftp.wied1606
  • gss.gshank
  • gunnylab
  • hcegbxbdrr
  • hiqult
  • ifdvyxcwlt
  • informar
  • isaiah-ee1001
  • jahiy
  • kra
  • laohao
  • leah-du0101
  • leobloom
  • likg
  • logistic
  • lz50mitchell4w
  • magic
  • mespacarreu
  • mmostafa
  • n11104
  • nhieohhqagtd
  • romm.chubfr
  • samuel-jm0901
  • sbnqdfnzutr
  • scifi
  • sl2
  • socwuwloz
  • suranga
  • swriteger79
  • tadyscugan
  • tororab
  • vg02.acc
  • www.cba
  • www.claimitemfreepubg
  • www.dunchan
  • www.secure-auth07asignin
  • www.verifyyours
  • www.vyso4ino
  • xrikronsdurrcc
  • zigefi76anen
  • andrew-dn1601
  • acc-validation
  • access-benutzer-dkb
  • c3h3-verificationx2
  • ci1izen-user
  • eddprepaidverification
  • ftp.ncsecu-mobile
  • postepay-verifica-online-fcs
  • user01-nfcu
  • webmail.my-tfcus
  • www.as10
  • ionapopg
  • john-up1201
  • lobby
  • netmaster2
  • to2
  • tracks
  • vicar
  • writeessuqw78
  • zonlicht
  • 06q93
  • 2539
  • adrian-ku1401
  • ajbk
  • anepenun
  • anraipegol
  • authenticate-postepay
  • b-office
  • bikerd
  • blythe
  • branch650088.fairstone
  • crispy
  • cszaqeir
  • deafi1306
  • dmsc
  • drifter
  • enbtxqfezp
  • fernando578463
  • ftp.annie
  • ftp.emp03wer
  • ftp.hodfleropg
  • ftp.srv-gate-38
  • ftp.steventhompsonf45w
  • ftp.support-empowerfcu-2z
  • ftp.validatemntb
  • gdpr
  • generations
  • genuine
  • georgescottm5l4
  • gnipi
  • gvofnychml
  • habitats
  • handloomproducts
  • heinrich
  • hrduoqliulitusina
  • inpoe
  • isabella-ua2802
  • jotunheim
  • jsp3
  • jwibuioblwfb
  • kcnhmznv
  • kist
  • l0punyxwth
  • laurie43
  • lbpyvvw
  • learning
  • menra1306
  • misterx
  • mixxd
  • moher
  • mospioglycam
  • nadoma
  • netcaboultra
  • nigcea1306
  • nocloud
  • nqehoofyuaaub
  • ntf
  • o966r3
  • oeagu2on
  • p04.gm-p
  • packet
  • penkokouro
  • pile
  • ponsa
  • qelul
  • route-core-38
  • rubompur
  • secure-verifywles23
  • secure00-auth-citizensaccount
  • simadc03
  • skorpio
  • specs
  • steki
  • stsm85
  • swriteqdn64
  • tfbheqmxmk
  • tiraroslava
  • tschoepe
  • upwby
  • ut1m6ex3te
  • v6h576
  • verify-securec05bs
  • wityyb
  • www.cillos
  • www.citizens-debit2fa
  • www.devtymax
  • www.dwjhcwl
  • www.euroascensori
  • www.sijkiezo-rijie
  • www.trust
  • www.validate-53ccserm1
  • www.vantagewesttrust
  • xc3sgwfwfi
  • yuriy
  • yw4a6j
  • zglevws
  • zoey110212nx
  • 1200
  • 1938
  • 1jq5g
  • 1k8u22k
  • 2002
  • 30qck9jm
  • 4931xl6
  • 9274
  • actipro
  • afcu-support
  • almarbsl
  • apc6ir
  • arcom
  • bevetuft
  • buildnew
  • california-ne0801
  • campione
  • carmelita
  • cbpziwsavav
  • chere
  • chique
  • chongming
  • climasm416
  • conwieforcui
  • coollanparty
  • cruz
  • cwni.w3ik
  • dan22
  • dan27streetradio
  • djiiurvx
  • durant
  • dvoraheder
  • ea
  • en.vzlo
  • enba
  • essaywrcne99
  • fed
  • franek
  • ftp.31as3m6
  • ftp.cantodorio
  • ftp.info-verify-account-secure
  • ftp.kiosgamersx
  • ftp.verify-infosecures00
  • garten
  • geese-authenticate
  • georgebrowna14l
  • gp48gonzalez8g
  • guinuphe
  • herstellen-icsportaalclient
  • info-security
  • ingelec
  • interadio
  • jacqueandjesus
  • jamesharrisy68p
  • jisocadd
  • js63nelson0d
  • jytsa
  • klever
  • leran
  • liborio
  • ligdibi
  • likoiab
  • link.blynk
  • lisa1
  • luqui
  • marine
  • messagerie
  • military
  • mrdiyppj
  • neria
  • netcom
  • noahnet
  • nzcf0104
  • pa.vzlo
  • pdexu9el
  • pennsylvania-oc2303
  • popopopo
  • puhohen
  • qolgpbwfpry
  • serco45wan
  • sesame
  • sins
  • snezenibecawokayiqitaudr
  • stroyelektro
  • succession
  • tfsh
  • then
  • tierra
  • titobdvq
  • trieste
  • ujjaqoaw
  • vedestwali
  • verify-account1k
  • verifyusb05-secured
  • www.diseos
  • www.freefireramadhan
  • www.jula6aos
  • www.kb37hall5z
  • www.kot
  • www.michaelmitchellz87a
  • www.ncsecu-org-iu
  • www.onlinebanking-secure-login
  • www.secure-verify-53
  • www.v01siz
  • www.vstar
  • www.wellsfargo05server
  • wxpt
  • ykago8iy
  • znapwpggpq
  • ftp.3rvers
  • login.poulsen
  • secure-information-verify
  • tis
  • tun2x02
  • vvardja
  • bryanivy
  • 1215
  • 1849
  • 1raibechssal.kosar
  • 27h13s
  • 5y53f19
  • 89149
  • 9050
  • 997nc58n
  • acefair
  • acurafuseboxschematic-softfilesxf2405
  • adriana-fh1301
  • aknadbvifp
  • alerts-secure-connect-wellsfargo
  • alexis-lz1301
  • alperso
  • amelia-yx2102
  • americanfirstlogin
  • askdesign
  • bear
  • buqenupobabelib
  • cacciatore
  • cal
  • cara
  • carsoni
  • cduus9hrds
  • check
  • chloe-ct1401
  • christian-zv1101
  • citraindahk24
  • clgerwick
  • clubesoris
  • co
  • corporesho
  • corvallis
  • cris
  • curdio0507
  • dagololv
  • dbgrz
  • del-onesrvcs00
  • dhanemafak
  • dipstick
  • dom
  • downers
  • dqibe0id
  • drae2318
  • dylan-bz0901
  • e-cloud
  • edmond
  • eegfazit
  • efb
  • emily-ur0801
  • emy
  • enjoy
  • eoqan
  • essaywrlgg31
  • ethan-ga1101
  • expertnetlink1
  • f195lo
  • favori
  • fedabonb
  • fi36campbell4x
  • fickgresacnab
  • fifth-3rdverifyacc
  • fijix
  • flexnetbrotas
  • flipzone
  • forca
  • ftp.2i9t3w0h
  • ftp.918m3c
  • ftp.citizenbankonline
  • ftp.container
  • ftp.mysrp-hold
  • ftp.oscar28
  • ftp.pictionary
  • ftp.usinformation
  • garic
  • gerabelley
  • germano
  • ging
  • google462pl
  • guideprofileeb
  • harper-qo1301
  • hawaci
  • helen36d
  • helicopterexperts
  • henry-rd0901
  • herman
  • hjames3td
  • hoover
  • hotels
  • hummel
  • ian-cx2812
  • icej
  • inacio
  • include
  • infosafeuser-postdata
  • ip.jiongge
  • irvine
  • isaac-ep1301
  • jbk
  • jcsp
  • jelitusa
  • jike
  • joshua-fm1101
  • jwn
  • khloe-kl1401
  • khloe-pi1001
  • kycraft
  • ladeela
  • lanka
  • ldm
  • letiwxev
  • literela
  • lng
  • lucy-zb2602
  • marcuccicasa
  • marionas
  • mhddatum
  • mhwxidw
  • mkmbluiz
  • months
  • mtg
  • mu69rodriguez2l
  • n-force
  • nibezoy
  • nspptdhmaw
  • nunewod
  • ofblog390
  • ohipmml
  • olan
  • openid
  • outof
  • oxevgbxprz
  • paarl
  • piotrowa.ware
  • pmc
  • pombal
  • pretoria
  • qrinxopzef
  • qt75martinez6y
  • rally
  • rbcasa
  • regn
  • rema
  • rgbdoywpgkkq
  • rgqdviovsp
  • riosnet
  • ritz
  • ruin
  • rupukfec
  • ryan-bz2102
  • sajal
  • salatino
  • samantha-qo1101
  • secure0d-bank
  • sgjwuke
  • skn
  • skvih
  • sugibhwh
  • sungshan
  • svcr0104
  • swr
  • swritelbk95
  • swritemyq92
  • sxtx0402
  • sz6ge3ur
  • telnetrafaelcantv
  • tesla-au
  • tyler-al0403
  • uhdtv
  • venditte-theatre
  • verify-cb07secure
  • vfwfa3v
  • vg20.acc
  • vogs
  • vrl
  • vrsk
  • vyrojiaxkggeaanr
  • wada
  • wholesale
  • winestorez
  • womdfse
  • www.0-vantagewest
  • www.a4ma8ij
  • www.activ24submted
  • www.bb-systeme
  • www.citizens-status
  • www.docent81
  • www.join-whatsapp18
  • www.kijoluppuj
  • www.klinsmann750
  • www.legion
  • www.moea
  • www.muamanguon
  • www.panther
  • www.pocketfold
  • www.printburo
  • www.pycniq-ontvang
  • www.rsadekvqbb
  • www.secure-mx-core
  • www.shopmaivp
  • www.smotri-vuuteh
  • www.swritemiq85
  • www.truist-com
  • www.vantagewmember2
  • www.verify-vantage-westcu01
  • www.verify03s-secure
  • www.waspie
  • www.zltzrfmnka
  • www.zxiodlopeloo
  • x1loxkxbslfhf8
  • xmcndgqckg
  • yijahkup
  • zoey-cy1001
  • cash.app-secure415
  • chat-grupviralbkp2020
  • gitlab.doodubs
  • huntington-authentication
  • neves
  • thisisonlyatest22
  • webmail.myc-stcu
  • 2404
  • 5877857751
  • 58yqcw
  • 7031
  • aaliyah-yh0901
  • account-info07-vetify
  • addison-kz1001
  • adiujfn
  • agg
  • agjsbnavypc
  • antony
  • arctic
  • ashley-br1301
  • axway
  • b01112077428
  • baatting
  • bbx
  • belambraclub
  • bewerbungsmusternrxx
  • brantley
  • brogyanyi
  • byd2203
  • camila-ag1401
  • ceit
  • childbechsfea
  • chilly
  • chouettes
  • cmd
  • cnc
  • cpanel.freeuc-10.00
  • creamy
  • cxwbqlqgkj
  • d0owveo
  • dan252streetradio
  • dating
  • db87lopez7t
  • didi
  • dj27carter3v
  • dk2k
  • do-305
  • earnpostcard
  • esas120111.hkr
  • essaywretl34
  • essaywrxqu00
  • evermore
  • fengsoft
  • fepztceeekd
  • firing
  • florida-gc1401
  • francos
  • friday
  • ftp.citiz3nsverifyal3rt
  • ftp.dgvawefx
  • ftp.diana
  • ftp.ecu-svccenter1
  • ftp.filedisk
  • ftp.kmfzlpgxufzx6jy
  • ftp.mecifmebt
  • ftp.pamukkale
  • ftp.portalaccess-infoauth2
  • ftp.tafoyn
  • ftp.taoshopcheap
  • ftp.verification-chase027b-securityhost
  • ftp.writeessisw78
  • fv82brown9r
  • gianna-vk1101
  • giskard
  • gonqpkwutnf
  • grefdiol
  • guideeaq
  • guma2
  • gy5dn5ou
  • hawaii-lg0901
  • hempkvpdzg
  • idkddf
  • ionei
  • ip01
  • ixnqd
  • jiao-hua
  • jj55taylor7a
  • josephbrownu08v
  • jshpbxylvtuv
  • june04231001
  • kapu
  • kat-bms
  • kindots72esdas
  • kiusnyukiol2
  • kobo
  • kv6dl5zi
  • liap
  • linkpidet
  • liquidnationmarine
  • loginwellsfargo
  • mail.headline
  • mail.pajamas
  • malaga
  • manlleu-wifi
  • manmohan
  • michaelscottf91b
  • missouri-ej1201
  • mistergav
  • moa
  • na-ac0801
  • nkbyirkdnm
  • north-ck1401
  • nuvve
  • o6s60
  • omegapoint
  • paola-oh1401
  • pkurusup3in
  • pr48nelson9m
  • praew01182112
  • pregnancy
  • proklamasi
  • rasha
  • rd02king5q
  • re63young3h
  • resov
  • rfbtvgkhxnua
  • romeo
  • schuth
  • secure-serviceecu
  • securelogin-postepay-jfg-feed-bancoposta
  • sercom
  • serwood
  • sever
  • sfjo
  • shoretoshorelandscaping
  • silvioricardosoto
  • sjaf
  • sofebowdll2346
  • sophia-rp1201
  • sri
  • staffing
  • step-papeete
  • sttimothy
  • swriteigk26
  • thirsty
  • thomaswilsonh29x
  • thvoft
  • tjun588.hkr
  • tk58cn22
  • tkfk1203
  • tokio
  • tomatopremium
  • tudal
  • tyler-ir1001
  • typi
  • ucsf
  • vault.desaes
  • verifica-postepay-sito-aggiorna
  • verify-accountly1
  • villas
  • vinew
  • vod.bar00
  • wam
  • wb60harris3c
  • west020212os
  • window
  • wisconsin-ql1101
  • wjat.w3ik
  • women
  • wortmann
  • wow.madcad
  • writeessrnj53
  • writeessswr31
  • wtliving
  • www.8o0uqm6
  • www.afc
  • www.afcu-contact
  • www.ch45e-ve7ify
  • www.cloud-mta-56
  • www.davidbakerd57c
  • www.dc55williams3v
  • www.dcu-org
  • www.del-onesupport
  • www.ecu-support-verifyaccount001
  • www.effie
  • www.excelfile-z6
  • www.fogojzels
  • www.hb
  • www.hotdoc
  • www.kkabc
  • www.lorge
  • www.mischief
  • www.olga
  • www.qq1y007
  • www.schumi-ds
  • www.serwood
  • www.think
  • www.ttjer
  • www.verify-del-one-fcu-user002
  • www.verify2login2g
  • www.verifyd909-secure
  • www.wboovxuakyuuhgie
  • www.writeessesy00
  • www.yaqulu
  • www.ytisniro1988
  • www.yyalebuvarini
  • xb09evans5n
  • xcmd
  • ycnrr
  • zimdba
  • 7e2izj0
  • cincinnati
  • ftp.essaywronb97
  • fybjasoxi
  • hdmedia
  • ldb1962
  • malzbier
  • mqubdmvjpd
  • ntuc
  • till
  • vitechbest
  • vsz
  • www.fcentr
  • zenith
  • www.801-americafirst
  • chase-verify01c
  • file.tszho1214
  • finans.poulsen
  • firewall.mydata-hub
  • interview.tszho1214
  • iqofw01-wan2
  • mail.apple-id
  • mr
  • pschramm
  • seagull
  • sick.appa
  • sirotrade
  • www.secureconnection21b-chase-verify
  • y7et6
  • 191
  • 5879308532
  • accounthelp-ecu4
  • acm
  • administration
  • airess
  • appliances
  • apticx
  • arrowhead-003c
  • bj-office-fw
  • bjkedoah
  • bluewave
  • bpspecter
  • broadsword
  • bucher
  • bukjoploki
  • california
  • carolkrzd
  • cdp44
  • chapin
  • coralguidewv
  • cpiz0602
  • cras
  • ctg4
  • cthulhu
  • dayoftomorrow
  • disd
  • dki
  • dns2name
  • dtzc
  • e21s3xjcn3k
  • equella
  • esp2597
  • essaywrdpa08
  • fernandocoelho
  • fkv
  • flagamcounre
  • frankh
  • frisapcomsi
  • ftp.secureaccount-amazonsitepage1
  • ftp.veriify-53apisecur
  • gg87wright0n
  • grumpy
  • guipeti
  • gyszabo3
  • gz64adams2r
  • harper-co1603
  • hmlqqqlflro8xj
  • homes
  • htasi9uy
  • htv0503
  • hwica8is
  • icedpahys1205
  • idaho-pl1401
  • il1bf5qe
  • isabella-hg0303
  • kamila-jm1201
  • kersrannewstecde
  • kevin-fx1501
  • khloe150112qe
  • lawn
  • mallofindonesia
  • mddernwhexlb
  • mexaa
  • michi
  • mpb7155
  • or01moore7j
  • paisec1406
  • panam
  • pandangan
  • prevworkginess
  • pss
  • qeqydwrzmw
  • qr
  • relocatable
  • role
  • ronaldonetwork
  • scrum.bevin
  • shekan
  • speedtec
  • suporteleao
  • swritebwg95
  • sylvester
  • timoigug
  • totev
  • tutao
  • tyler-zf1201
  • uqxn3
  • uykakbmkds
  • verificca-postepay-id-04601128800a
  • verify-del-oneservices02
  • williamhallh58a
  • writeessape02
  • writeesshnf62
  • www.agjsbnavypc
  • www.apr-citizens-sec02ax
  • www.desfiado
  • www.kikenucp
  • www.lux
  • www.michonne
  • www.shopdatgm
  • www.verifiedinfosecure
  • www.verify2login
  • www.well-53cur3-verify-x2
  • www.xehoqifqok
  • yomakgazs
  • 2hat98
  • 31as3m6
  • 4ug96gyc
  • 6axyvn
  • 76vs557
  • aaliyah-fq1301
  • ae15collins7t
  • afcusupport-review
  • aiden-hm1401
  • alexis-hk0901
  • alicia
  • andersonmk05
  • angel-tm0901
  • anywhere
  • apoxe
  • atif
  • baltimore
  • blaackmaagic
  • bonatecadm
  • bpzw
  • bsd82vldsk
  • buha
  • bwsoeaiyfdzueadj
  • cadebosrau
  • campanie-email
  • christopherleek69r
  • ciamanka
  • cpanel.groupwhtsappbokp.00
  • cpcalendars.userverify03
  • dan13streetradio
  • daniel-mu2102
  • danukruj
  • done
  • dswe5
  • dtmedia
  • dwwpc
  • ecusupport2
  • edrzozqskq
  • elizabethf
  • eoijlnmmey
  • ermlonottia
  • essaywrnod03
  • eternity
  • evchenkocl.i1
  • event-horizon
  • faith-jg1101
  • faojqqcbr
  • flore
  • frias
  • fstrade
  • ftp.free-dm-2021
  • ftp.lithiumreserve
  • ftp.rb750gr3
  • ftp.saabreathgize
  • ftp.serov
  • ghost1987
  • gifted
  • gigi
  • gozol
  • guideistbg
  • infinity-rohan
  • inna94day
  • ip.milacron
  • ipnvfojbwg
  • ishida
  • kamdor
  • ld82allen2q
  • lew-wrzol
  • lhc
  • linz
  • llerrzulzzj
  • lucky
  • lupubcodj
  • lvhome
  • mcswain
  • meme
  • mkfuncionarios
  • mx-service
  • nepottiro
  • ocuwidupiwetusoxonomoafp
  • onedrive
  • ooitilwprg
  • picker
  • pjoqa1og
  • plo
  • postepay-safe-login
  • preoccupied
  • prisma
  • project
  • q9o1x3
  • qikoo000.hkr
  • qmzaciapsvh
  • qt80baker2f
  • quattrosoldi
  • qxqgmnerodt
  • rimjk
  • rivok
  • rocinante13
  • rotilrestges
  • rwfnxxukccziwaj
  • sarantis1
  • sniv1
  • sorvo
  • sqpzpcpss
  • suncoastcreditunion-help
  • swritekpe93
  • teks
  • testjf
  • tothbcbqvqzv
  • trail
  • ultinet
  • urgaaedcyf
  • utah-vp2401
  • ventouris
  • verify-del-onefcu-user04
  • verify12-secure5
  • verifyinfosecure02
  • vnet
  • www.4z2ykk1
  • www.celeste
  • www.concepcion
  • www.eladio
  • www.golfovod
  • www.secure00-auth-accountonline
  • www.sembrongdam
  • www.solvathellam-ohne
  • www.verify-account01
  • www.wedoveqnoi
  • www.writeessbel64
  • www.yadefyxxvemkr
  • wzzzg
  • xfazurlaoy
  • zeqexapa
  • zjtpts
  • zq44collins4j
  • zvfg
  • zz1kn7
  • w7brtjlrol
  • cpcalendars.chasseveri-ident
  • discourse.marty
  • euau
  • mum
  • ulepsa-rivadavia
  • 1871
  • 3z6ql9
  • 44e7b81
  • absepurpe
  • allison-ln1001
  • allrich
  • aovegixu
  • appleseeds
  • b10
  • backup1
  • berkut
  • blp10
  • brettendaden1205
  • bureaucollective
  • ceworsgete2905
  • cicreisebro
  • coventry
  • dafni
  • ddxhs
  • essaywrrtz19
  • ew62johnson0z
  • fbwsfgueojkg81
  • freefire-2021
  • ftp.27h13s
  • ftp.pharbthzei
  • ftp.sonia
  • ftp.szizugmuricutexn
  • ftp.verify-account000
  • ftp.verify-ecu-member02i
  • gabriella-jf1401
  • gtwood
  • hcbridges
  • hm46smith7v
  • hxel
  • iexpfpavgjsa
  • iqighana
  • issjobsuche
  • jessa1
  • jewelryreview
  • kamila-hd1001
  • km55carter1f
  • koda
  • kzdmvoe
  • lquattro
  • macserver
  • mamapospau
  • medex
  • michaelwilsoni77i
  • morojlaem
  • natan
  • nixvil
  • nusayqozd
  • okopi6oc
  • ovdmchvcla
  • po
  • postepay-login
  • prairie-tron
  • psg
  • qmzxaa
  • qpcm
  • quik
  • recommendations
  • scldbj
  • secure-redirect
  • si68nelson3e
  • skinhair
  • southturncc
  • sunashdod
  • t74
  • tihqlijey
  • trmj
  • u6invu1z8or
  • uedson
  • umvmcc
  • usaa
  • webapp.actc
  • wecktermoa
  • whats
  • writeessqyn00
  • wt74collins0t
  • www.4k786
  • www.aberdeen
  • www.chase-online
  • www.checkmxtff
  • www.ecu-userservice2
  • www.orabankbeninonline
  • www.paubuzzpowmii
  • www.prof
  • www.qb0xn4kr
  • www.ua08carter2t
  • www.uinformation
  • www.william
  • xasemgxugdys
  • xcgr4
  • xh26campbell7x
  • xn33jones7q
  • yelp
  • zazah
  • zlaplvjcsx
  • zole2wun
  • zv30phillips7u
  • 27001
  • 5j42kfm
  • 6208
  • 97219
  • adema
  • agriculture
  • akdayala
  • aknovosel
  • alberto467
  • backups
  • bcube9ov
  • cadet
  • chass
  • chloe-mb2912
  • christian-cn2102
  • ciinhq
  • coa
  • dedimarco
  • dercrunpaquar
  • division
  • eats
  • edgqz20
  • esordecent
  • estudi
  • f9qsn3
  • fcm
  • files95649
  • ftp.camb
  • ftp.essaywravy97
  • ftp.misa-apartment
  • ftp.qatar
  • ftp.secure-redirect9
  • ftp.stickers
  • ftp.verify07bserver
  • ftp.verify53
  • fu75baker6y
  • gavin-ry1301
  • gecaro
  • gnll
  • guardian
  • ha6in30xrs6tp
  • healthylove
  • helin
  • hooqvynvoac
  • hp
  • isg
  • jeff5vvd
  • jerking
  • jfgag
  • kamax
  • kansas-ud1101
  • karen
  • kiakal
  • launch
  • leituthulen
  • lily-vq1101
  • luis050112ps
  • mail.45
  • mail.biology
  • maporthmal
  • marina6
  • montana
  • mwnetmurilo
  • naturecloud
  • niftythrifty
  • nizamuddintemp
  • not
  • obmatatesti
  • oq89phillips4h
  • other
  • ottawa
  • outdoorpark
  • pfuhu5am
  • piggly
  • pikao
  • poma12
  • quetta
  • ranchguidecg
  • rkr0102
  • sala
  • sittercity
  • sqabunluniwopimz
  • sunil
  • sweels
  • swriteond46
  • sy04green4p
  • syijbhhqigz
  • thecore
  • togetherwecanmake
  • valeria-hh0901
  • veritas
  • williammitchellu75k
  • writeessczo69
  • www.0acisj8r
  • www.acctassistdel-one
  • www.adobe-document
  • www.billing
  • www.cacciatore
  • www.certify-vantagewestcu009
  • www.del-one1actvtlp
  • www.faiqe5iw
  • www.fxinesa
  • www.gmail-account-management-center
  • www.mta-mx
  • www.ncsecu-org-bank-secure
  • www.onlineaccess53rdenrollonlinebankingservice
  • www.rs220
  • www.secured-alerts-citizensbank
  • www.service-en-ligne
  • www.wajabebo
  • www.williamedwardsr85h
  • xm419
  • yannetta
  • yh43miller1x
  • zf06baker5l
  • ftp.southwitham
  • c0wboypc.c0wb0yhome
  • online-support-wellsfargo
  • painel.cstopbrasil
  • secur2xchasewizzyconnect21
  • 1945
  • 1xl43101u
  • 4b50ll5k
  • 6222i7j
  • 6n199q2
  • 7k8o1c1a1
  • adeel
  • adr
  • aimixess
  • arizona-go1201
  • au3n7rok4
  • authorised-bankportal6
  • authorize-user
  • booker
  • brayden-mo1301
  • brothers
  • btroop
  • bz2qz9p
  • bzhsteven
  • cajiruxuevjio
  • cdrjdkzhkga
  • cgaoqebu
  • chen
  • cmnet2
  • coag
  • cooler
  • cuantic
  • cuanto
  • czubatynski
  • deoc3
  • dialogs
  • drmkey
  • dw19williams4f
  • efgprivatebanklimited
  • emma-sd0503
  • essaywrecl67
  • essaywrkfm45
  • essaywrqao81
  • essaywrqbg54
  • essaywrxao88
  • estoquegeral.ahsr
  • fj73210.hkr
  • flexcloud
  • flip
  • formation.reparlab
  • free8
  • ftp.authorized-bofa
  • ftp.chaiyo-nb
  • ftp.citizenbankauthorization
  • ftp.ellen
  • ftp.gmiea3d9huwga
  • ftp.mqubdmvjpd
  • ftp.ncsecu-org-onlinehelps
  • ftp.questionnaire
  • ftp.securewells-fargo
  • ftp.verify-ia
  • ftp.zlav10
  • fundapat
  • fzwmenngogbe
  • g7ys1oxzphf
  • gabuinter
  • genesis-xc0403
  • geofun
  • gunungputribogor
  • gwimwz
  • hal
  • harper-am2401
  • hm12nelson8p
  • hmsmvivo
  • homenet
  • ib84johnson0e
  • idcoruben
  • ilhievwaijgii
  • ilunal
  • iq03lewis9m
  • james-hx1201
  • jaremi
  • jjoeorfauuyepegd
  • jnva
  • john-uy2812
  • k24cisangkancimahi
  • kaydysthona
  • kcmz8
  • kdc-athome
  • kentucky-na0801
  • kevin-wj1101
  • kingfish
  • kkmmcc
  • kujeqpesdn
  • leland
  • luis-ct1401
  • luister
  • lulivepi
  • macbook
  • mail.sanders
  • mails
  • marko
  • michaeltaylora91x
  • mjihd
  • mmg
  • ncsecu-org-iu
  • nd
  • nipples
  • nujk
  • nukh
  • nycv0103
  • offbeat
  • omeziva
  • paper
  • pbpsdh
  • pentagram
  • pert
  • pgw1403
  • piazu3ew
  • pospostepay932576
  • postepay-myposte-verifica-dei-dati-online-sicurezza-vff-ppos
  • projecthome
  • qcdcphb
  • randy
  • relay365-gate
  • robertparkerg45x
  • rpl45zto8
  • rv27king1s
  • safh
  • secure07cinf0s
  • sh83walker8a
  • shibden
  • shopgamefaifai123
  • simplybonds
  • smog
  • socitel
  • soff
  • sofia-pe1101
  • strudel
  • sunset1
  • swritenjr37
  • swriteryz86
  • tennessee-lj1101
  • texas-wt1101
  • tieusoi
  • timbernet
  • torrent.vehel
  • truongnh
  • txqylzrwuowye
  • ultra
  • vg41.acc
  • vw58perez7p
  • warner
  • webanywhere
  • writeessbub58
  • writeesscla24
  • writeessmst63
  • writeesssym44
  • writeessvxg33
  • wrjphjzsgm
  • www.253djo2
  • www.841c8d
  • www.adeilsofi
  • www.adobereader-file
  • www.ankara
  • www.anthonymitchellm82f
  • www.anthonythomasz15c
  • www.blushine
  • www.branet
  • www.brewuloid
  • www.coaka
  • www.cuamerica-accthelp
  • www.ecclicinon
  • www.ema
  • www.fabrybt
  • www.gwcuu23
  • www.labnanni
  • www.loginauthorize-update05cverify
  • www.netflixsecurity
  • www.new2-rtgnhe3
  • www.ophlobottdob
  • www.qhhxvawyfttp
  • www.rabo-pakketnlomgeving
  • www.trenje
  • www.update-secure-verify
  • www.veri7y-7nf0
  • www.verify-secure02
  • www.verifyaccsc03-secure
  • www.verifyz53-loguscc
  • www.vvsshop
  • www.work
  • www.z7u1l
  • xinghestudio
  • yanchick
  • zmc
  • zu067
  • 4625
  • accgame
  • amerikom
  • bedrock
  • cl1
  • danesh
  • ftp.exclsvoffers
  • ftp.secure07-verify-info
  • ichra98cafoco
  • il
  • leader
  • line76
  • luenzu
  • mrvlz
  • new-yi1301
  • patonet
  • pihmiygmyy
  • pontox
  • rully
  • slainte
  • tadek
  • virtua3
  • vyso4ino
  • webmin.vehel
  • wscancf
  • www.account4bloginver3ify
  • www.chase01
  • www.secur0l-auth
  • jp68thomas7e
  • af1.serv1
  • cepecsrv.alia
  • f0rrest
  • fengyong
  • lanterne
  • luckyspin-terbaru
  • osvpaez
  • transmission.rpiathome
  • bettyn70
  • citi-verify-citiz
  • comforters
  • district-lo1101
  • dxuehiechguozt
  • educatorssupport4
  • esantos
  • firerelief
  • fitinge
  • ftp.cesnighprotet
  • ftp.cwwpkxmphx
  • ftp.elianakza
  • ftp.uspackage-notices
  • ftp.verify-srpcu-help004
  • ftp.ym08davis6e
  • gpe
  • guitemp68arar
  • halloumi
  • hannihonko.kosar
  • hennapoghafa
  • ibdabagdad
  • kejefrit
  • loydaneder
  • milut
  • misc
  • mjk5145
  • mps1.gc7c
  • nod32.engineer.xyz
  • onlinesup0053
  • originthai3
  • rel.vzlo
  • ryerson
  • s2b01
  • schulekarsau
  • swedotech
  • tapatio
  • thrd
  • www.csw
  • www.google3379op
  • www.gtpugqgglxx5hqg
  • www.odthwstlkd
  • www.official-word-mlbb
  • www.tratamerur
  • www.unlockcitizens
  • xb95harris9d
  • xgcjbxdvscy
  • z1024
  • zappos
  • 1a446l2
  • 1vccqq
  • 24521
  • 29th
  • 4806
  • 53-user
  • 7m1i7uejb
  • anacleto
  • athena
  • atlantiquebank-plc
  • boa-secure02
  • branch600618.fairstone
  • crmk
  • d7wlfe3
  • dan26streetradio
  • devvip
  • esl
  • essaywrxfg21
  • etienne-alexa-api
  • fcentr
  • feiertagfl
  • ferrospedros
  • ftp.53-user
  • ftp.claudvps
  • ftp.ctzn08
  • ftp.del-one-settingsuppt001
  • ftp.essaywrbkd97
  • ftp.ghuoczuoyzoovpee
  • ftp.rqe3t02qak
  • ftp.simadc03
  • gavin-px1401
  • gleno
  • hailey-bi1301
  • hely0506
  • hiezpq
  • hr19wilson4v
  • humanities
  • icacls
  • iftp
  • ijaki7ak
  • imaging
  • incon
  • integral
  • irycznrh
  • itfnjmgzic
  • jagai
  • jppkvuljio
  • kalafior
  • kaswef
  • katherine-vp3012
  • languagelab
  • lapko
  • liam-rm1201
  • lomil
  • luca
  • mastickshio0
  • mom
  • monitoring
  • myposte-postepay-servizi-online
  • mys10v8
  • natalie-tj1101
  • nicholas-gx0703
  • opiafo
  • orange
  • palmeiras
  • ppgrocy
  • qseipduuwguomtoa
  • raedjom
  • ripvuogsi
  • robinm
  • rootsnet
  • rt4membrillar
  • saopedro
  • scaur
  • secure-dns-srv
  • sewoo
  • sgdhbehf
  • slw43
  • ssrecord
  • susanblog536
  • szawadski
  • togoegqagepecue
  • uaqasiq
  • ubo
  • unepomme
  • update-personal-info
  • utafuyuhizoqiza
  • utah-uo0203
  • verify-ecu-member03a
  • vw12brown2j
  • warriors
  • webmail.securehost-verify03-chase
  • wecantalk
  • wpdev.amcrohost
  • writeessqki74
  • wv73wright2j
  • www.0qkd12
  • www.1g01y34
  • www.blogdeborah779
  • www.bmpniopngc
  • www.del-one-supp00
  • www.euhnw24
  • www.ghosting
  • www.mnanibuo4ek
  • www.phoebe
  • www.postepay-aggiornamento-banca-italia
  • www.schlachter
  • www.secure-update-security
  • www.sfera
  • www.sniffer1
  • www.vamericafirst
  • www.video
  • www.windtunnel
  • www.xfpcwf
  • yadiel-co1601
  • dayofdoha
  • dg5tq3a
  • everest1
  • khayal
  • kl
  • pastels
  • rembbaw
  • www.6172na
  • www.group53-secure-en-us
  • www.mt-secure08
  • www.pycniq-bnp
  • 7i9sj
  • alexalex
  • aopajaohae
  • bireports
  • cairo
  • christopher-ae1802
  • chucky
  • cpc
  • daybraswehrlo
  • fahdac
  • ftp.comral
  • gustavocruz
  • harder
  • horavance
  • iupuxi
  • khattabah
  • labweb
  • maine-jd0201
  • manow00181001
  • mesh
  • miuqemehieaiogbb
  • mp-obp
  • nevada-bv1001
  • nevaeh-kj0801
  • nicholas-fs1301
  • osevdyna1811
  • pergdesudi
  • ppwrjtc
  • pt1
  • rodlop
  • rusgoggos
  • silkmerrazgles
  • socalaka1511
  • sspecial
  • sstefano
  • swriteyct34
  • tennessee-te2601
  • worrezhiti
  • www.auth-53-secure-en
  • www.balononse
  • www.ec242
  • www.gkoyps
  • www.program
  • www.secvre-huntington
  • www.verify-ppsrpcu-help00
  • yavin
  • zivko
  • wiggly
  • 3bet
  • ftp.help-securecitizenbank
  • ua-budget
  • 1492
  • 8548
  • 8uiziyse
  • 97783dl
  • adriana-lh0303
  • alert-supportteam
  • angler
  • arjlyqylenfwx
  • baublenvisrei
  • blogbyphb
  • bmofeldtour
  • bo
  • bronx
  • brooklyn-ky0703
  • canjaiworlfer
  • casey
  • cdproject
  • changelife
  • chizh
  • cryptoservice
  • david-cd0403
  • dccc
  • dp0030411
  • elizabeth-zd1501
  • every
  • ex
  • faqs
  • focv1003
  • ftp.17
  • ftp.hqqbmfzfgs
  • ftp.send365-secure
  • ftp.swritefcr91
  • g-hq
  • hheivi
  • hip-area-clienti-intesasanpaolo
  • hitibotice5r
  • home.ptcryan
  • hqapgphv
  • ian-vc0905
  • ih768m9
  • iktwvs
  • inappropriate
  • isabella-qa1001
  • isjinmapo
  • jack-li0101
  • jane39222402
  • jhoao8f4ruxdi
  • joy
  • landon-zh0102
  • lhefapyoiiyukuyq
  • liberator
  • likged
  • lldb
  • lucas-gv0204
  • mackie
  • madinpostta1979
  • maibracmojo
  • mail.run
  • markoz
  • mhz496
  • mondelio
  • mta-mail
  • ncrfmwyenc
  • nlicla
  • np59baker4m
  • npkdb
  • oldape
  • omefigogapopora
  • owrk
  • paulsmithp46l
  • picbplymzo
  • proservecorp
  • puffs
  • qifcvziyxcg
  • qojiwut
  • quvoxur0iq
  • re36hernandez1d
  • recorder
  • responsibility
  • ringguartide
  • ronaldparkere82d
  • rt12jones3s
  • schildi
  • searchbentico
  • secure-verify-host-paypal03
  • secureyouraccount
  • shzagdgwr
  • singer
  • sirak
  • sl.smash
  • souvenirs.nocloud
  • syt
  • tafoyn
  • tamago
  • tf15martin2x
  • tfjo7
  • tiptoe
  • tracey
  • trailblazers
  • user
  • ve01turner6f
  • verify-information
  • verify-vantage-westcu-user08
  • vorschwindeln
  • writeessejm54
  • www.ameasboabrisra
  • www.antomax
  • www.ceci
  • www.christopherrobinsong10l
  • www.citimobileauthorize
  • www.del-onecontactsupdate
  • www.discover-cardonline
  • www.exe-view
  • www.foagkindl
  • www.posteit-verifiche-aggiornamenti-online
  • www.pxoanyiicxklsaiojp
  • www.qseipduuwguomtoa
  • www.ranhome
  • www.recounter
  • www.secure-verifycsb7
  • www.vbhome
  • www.verifyinfo
  • www.verifyxc1s-secure
  • www.vguideon
  • www.yowojnol
  • www.zw04brown7l
  • xahucel1xv
  • xicuviyinnb
  • xzhopeqzee
  • ycsdvoexlpmouehf
  • yokalink
  • zdubcswbr
  • zxuqozxoqinukucr
  • 0v4wmp
  • 3mk1i07
  • 6prkb2xp
  • amber1406
  • americafirst-webonline
  • antipasto
  • ararlemro
  • carlosgabriel
  • cillos
  • crockersfarm
  • domisero
  • download2971file
  • eisuce
  • farmaervas
  • foreman
  • fr
  • gnep
  • gomugeneentia
  • grace-hm1101
  • heyojiaaaf
  • hilmexzvy
  • hl56smith7h
  • ijiqotoweith
  • imola
  • isolan
  • jane06090601
  • jxasujqueuvuyarp
  • knigge
  • kynhuwtbmwtkg
  • ladder
  • lakers
  • laurel
  • liyufeng
  • loverazcoll
  • mail.userverify03
  • mg87kdaevq
  • nddy0104
  • nicholas-oy1201
  • ovcharenko
  • pompano
  • porisindah
  • princess
  • qhknvwqtcq
  • rvs4000
  • scoobydoo
  • sgvnet
  • southampton
  • storage
  • sutapfusswi1005
  • swriteijr00
  • tmikued
  • ueipgupo
  • www.2fa-am3ricafirst
  • www.citizen
  • www.citizenaccounttest
  • www.diagrouneccom
  • www.fargo075-secure
  • www.verifyinfosecure
  • x3f9guspoo
  • xx76king9y
  • z53w55q
  • 5490
  • 8726
  • abate
  • anna-tc0901
  • jackson5557
  • limoges
  • mmspecial
  • portal.tv
  • py
  • qrxpcvoepf
  • rw81lee5v
  • sansit
  • sdiqo8is
  • theaddress
  • thefoolm416pubg
  • trenje
  • tuni
  • wrininsume
  • www.itr
  • yrqiciygdxw
  • usenet
  • acv3
  • jpmverifcation
  • login.northlane.comnotice-rcclnorthlane
  • mail.nets-dash
  • uat.9ut.7stechnology
  • val-lcya
  • 051i4zd
  • 1212
  • 18th
  • 19022
  • 2390k07
  • 2i9ohb5
  • 525r1aa
  • 743uksr9
  • 933752c
  • a7573t2
  • adbruxinab197424
  • advocacia
  • aerotecnica
  • aiden-au1301
  • alexander-pi1401
  • alexey
  • alexis-mk1902
  • alhashimi
  • alper
  • anis
  • anthem
  • askos
  • authenticate0850
  • bivujvrmjewjx
  • brno
  • bucxkbqg
  • byv0503
  • california-zc1101
  • ccsfgq
  • cdcx
  • chryslerswitchdiagram-uiz0512
  • cikini
  • circlerecord
  • college
  • comneugonzu
  • connecterra
  • contract
  • correacadal
  • costs
  • cpunlimited
  • dangerous
  • dany
  • david-rt1001
  • ddoc2024
  • demofada
  • derbmejecda
  • devon
  • dialiporwhe
  • diego-vr1201
  • dkc3010
  • dlklsrrkno
  • dohhh6
  • drkp
  • dwxuhmflfq
  • dzvpfshspig
  • elenapc
  • enlaces.adeinor
  • estrella
  • farzi
  • florida-gh1401
  • followtherules
  • forceclairvoyant
  • frankfurt
  • fronofliastear
  • ftp.207161h
  • ftp.emdc-cloud
  • ftp.jfjzc0k
  • ftp.pp99allen7a
  • ftp.secure-server23verify
  • ftp.secure04citiweb
  • ftp.straytv
  • ftp.tantrum
  • ftp.verifyaccounty02
  • fyjohizafoemj
  • garenafreefireindo
  • gateway-dck
  • gqaorc
  • greatwork
  • h2y3coczoo
  • hailey-ko0801
  • help-pageamazonsecureaccount
  • hungra0507
  • hvaiymulalue
  • ieyodirn
  • info
  • info-approval03d
  • information-security
  • intranet.axtech
  • iu19johnson3p
  • jackson-dr1201
  • jeffersonstewart
  • jimisuy9zg
  • jiuda5ay
  • johngaio
  • joshua-ut1201
  • jsh
  • kalona
  • kmewn2
  • knajf
  • lawnjuncdons
  • lila
  • lillian-xs1001
  • lmimbwhkduf5rrp
  • luvdimuk
  • lynton
  • maine-zo1501
  • megimmune
  • memonezakee
  • moirhoddasubf
  • mpebckqmtieirhbc
  • mrkuqxktgu
  • mzahi6av
  • narkhotik
  • neonet
  • nightmarket
  • nk83robinson0a
  • noble
  • normas
  • nuttkujnjojo
  • nuyaszer
  • nyan
  • orangedog
  • orgklfdr
  • ox57wright7y
  • oythlwpj
  • phiga5os
  • probst
  • publishing
  • puerto-pn3012
  • pulling
  • pumpmarnorill
  • qx2cz5hj
  • radiantflooring
  • rated
  • robertdavisn38o
  • rockcastle
  • s86mknz592
  • s9ws5
  • sanatandder
  • sclimoeiro
  • securmycitizeninfo
  • seiwathanle
  • shilpa
  • siadah
  • smkn4
  • soho
  • sokol1
  • sparkfun
  • spda
  • spz
  • subjects
  • svjip30
  • swriteczn23
  • swritewra86
  • swriteynf98
  • swritezvs76
  • taylor-sy0101
  • tem
  • tempbalira
  • tepuxuyumenoneg
  • tfraxvkkikda
  • u3d
  • unica
  • v8xlbg
  • vatti
  • vbqvdbqsd
  • ve49white4b
  • videos
  • vmaxleclub
  • vpn.sdlm
  • vzqadl
  • wd71parker9f
  • webmail.gemsgratiscoc.00
  • webmail.joinbrad.00
  • wildyak
  • www.9t9m0oepj
  • www.authorised-bankportal6
  • www.bullet
  • www.citibank-mobilesecurity
  • www.davew
  • www.dercrunpaquar
  • www.dlmiosddhme
  • www.event-garena-02
  • www.fargo19-secure
  • www.hipchvjgzgitwiqt
  • www.jonnost
  • www.kirov
  • www.klbgocfrpe
  • www.lordpercy
  • www.manduria
  • www.mecolakw
  • www.msg
  • www.royalmail.com.rxs
  • www.secure-account-citizensbankonline
  • www.secure14citiweb
  • www.secureaccounts
  • www.sepanjang
  • www.swritecps95
  • www.tajijop
  • www.torg
  • www.vacfrvbvmx
  • www.vc1-well-auau
  • www.verifyrq03-manage
  • www.zest
  • wyatt-rk0801
  • yadlz20
  • yb31anderson8o
  • zbwin
  • ze03wright1o
  • zidz
  • coke
  • conclusion
  • fasizexuhenawijomagasi
  • gabriella-cd1301
  • herportsg
  • ibnebatoota
  • jyakymuvxv
  • koslesssufceber
  • markup
  • melusine
  • midias
  • nirmala
  • qandz111.hkr
  • reading
  • reevfviyockzbd
  • renet
  • skinkoffreemobilelegends
  • smuteminul
  • wanuni3mi
  • www.pubgfree
  • yadiel-ez0901
  • www.brf
  • ftp.ssml
  • lina6
  • login-account-dkb
  • row
  • www.secureconnection22b-chase-verify
  • alexzhubridge3
  • 0ac8tg5r1ke
  • 2431
  • 270
  • 49ej9ja
  • 700
  • a819238912-host
  • aboccia
  • adidarma
  • ads
  • agrox3
  • airbnb
  • airmedsrl
  • aliyun
  • amelia-tb2906
  • autodesk.yoyo.xyz
  • baezh4f
  • barsmint2507
  • bav-gw-beslan
  • blueplanet
  • boa-verify05
  • borsato
  • brasileiros
  • brl
  • businessline
  • buyer
  • bwc301
  • bwjqyo
  • c2-afcu
  • capoccione
  • chg
  • citizens
  • cliknow-whatsapp.00
  • clininen
  • cohepnus
  • dadoggy
  • dialcom
  • diensten-ontvangen
  • ejr9777
  • embisphere
  • enernoc
  • essaywrdzb54
  • essaywriod61
  • essaywrqdt93
  • euclid
  • ewcoe
  • fdjy67
  • fg
  • filebrowser.tramnhien
  • fishy
  • five
  • flipenemwris
  • formalwin
  • ftp.31275306
  • ftp.adcomma
  • ftp.cashsquare0net
  • ftp.cd49parker1c
  • ftp.experimentar
  • ftp.gateway-gate-75
  • ftp.jasonhernandezd40w
  • ftp.musical
  • ftp.navyfed-m0bileverify
  • ftp.pcv-s520
  • ftp.qg10white7k
  • ftp.reedemyourskin
  • ftp.send365-service
  • ftp.verify-accountly1k
  • ftp.winestorez
  • ftp.zolkins
  • ftp1
  • gaitraplelis
  • georgescu
  • golfalphalima
  • grxfsbr
  • gsm2
  • harper-lb1201
  • heimdall.luna-serveur
  • helpdesk-cuofamerica
  • hem0402
  • henewon
  • homeassistant.ben
  • homecams
  • hsk111
  • htillo
  • hufegaitu
  • inc
  • inuit
  • itstechofficenet
  • jasondavisp11q
  • jhjuycmteeq
  • jjmvy9y
  • kartinidepok
  • keds
  • kelapagading
  • kevin-uo1501
  • kingdom02
  • krumov
  • ktyli
  • ladygin
  • lcs
  • lines
  • lojacasaamarela
  • lopez
  • lostoysite
  • magiceupho
  • mai2
  • mail.pihome
  • malii
  • map
  • massachusettsbook-cko0405
  • massazh-prostaty-kliniki-mahachkaly.aledinpropru
  • mba
  • mcp
  • mid-cpu-hosting02a
  • mignoso
  • mlktnxplzqq
  • mohsinternational
  • mygov
  • mznvlu
  • nevaeh-jf1001
  • noah-sk0801
  • north-cz1301
  • nsp
  • nzibi5on
  • oatixnevu
  • ovp2702
  • ozivi9um
  • paefamisys1811
  • pauladamsk04w
  • pdmsqd
  • pedrolages
  • picoshare.ohmmanipadmehum
  • please
  • pma
  • poste-postepay-verifica-dei-dati-authority
  • pp99allen7a
  • proffesional
  • pvt1-wan.cmb
  • qxtx
  • renasnaiblad
  • rhieaighb
  • rockmedia
  • ronaldmitchellp62m
  • saojoaquim
  • sdfgryrfg
  • secure-server01b
  • securecitizensrest
  • shaka
  • siloe
  • sinotov
  • smason
  • sool
  • spektr
  • spooncomli
  • strzz
  • superman
  • tarrasqueballina
  • teamdts
  • test-cloud
  • testcam
  • tffktiqsmm
  • tg
  • tpt
  • ttm
  • tx37phillips3a
  • u2iykou9j
  • udsybujhzecd
  • unpos1306
  • uplive99
  • usla.gc7c
  • utah-ex1301
  • utah-oq1101
  • vdsl
  • ve20walker1a
  • verify-secure07b
  • verify1vlogin
  • vinger
  • virgin
  • vzmitrichenko
  • wjoseph0tg
  • wpay
  • writeessbzr50
  • writeesskka12
  • writeessqda78
  • writeessuau51
  • www.461fyo2
  • www.afcu-login
  • www.amco
  • www.beam40141312
  • www.c0wb0y
  • www.camb
  • www.cherub2020
  • www.dadujuxz
  • www.energyguideke
  • www.fudupanwoj
  • www.genjuroho
  • www.greijmans
  • www.help3448
  • www.hilvusdxpslcb
  • www.huntington-onlinemobile-security
  • www.nolimit
  • www.nyve1rify-acc09
  • www.offices
  • www.pbrihpmnleetvzd
  • www.personalid-verification07
  • www.ppc
  • www.secure-onlineverification
  • www.secure01
  • www.silverado
  • www.tec
  • www.tplktftwfs1os6o
  • www.truonggiang
  • www.vbqvdbqsd
  • www.veridiancu-org
  • www.verify-srpcreditun
  • www.verify-srpcu-sup001
  • www.w2r4o7w9
  • www.zwswpdwuzyan
  • xaladen
  • xcyop35
  • xerox
  • xey
  • xn39clark6d
  • xvbzb23
  • xzone
  • yus
  • zaeem
  • zsmkyujgzx
  • wtaffet
  • bobsonsilvia
  • ccl
  • digitstcu-org
  • my-email
  • norsmask
  • tbejbn
  • www.busisnnessmail
  • www.vps4
  • 2900
  • acdazjabth
  • aledinpropru
  • benbos
  • bftabogados
  • cpf-fibra
  • ctrgubifepop
  • ftp.alien
  • ftp.sayuti
  • fwds
  • gw500
  • kltg
  • l4ocytao1ap0o
  • narrative
  • new5-ertb3r
  • peiba1306
  • thinks
  • usps-parceldelivery01
  • writeessbvq57
  • www.arvsttcustmr
  • www.polred
  • cccamspain
  • 2501
  • 4xlm4s
  • 555
  • abend
  • aj14walker9i
  • amorzinho
  • andymcgow
  • anthonyjonesv15j
  • apanin
  • atc
  • aubwtyxzxth
  • babyshoppinghq
  • bcom
  • bein
  • biergarten
  • bless
  • blueiris
  • branch640685.fairstone
  • bravo7
  • breadth
  • brianjacksonq56s
  • browning
  • carmen
  • chryslerwiringdiagrams-filesrkn1805
  • citi-zenprotectacc
  • colorado-xg3012
  • cow2f
  • crazyschool
  • cred
  • ddigor
  • de97smith7y
  • del-0ne-cusupport02
  • descatacor
  • devtymax
  • digitaltech
  • district-rk1501
  • dltxkdr
  • download8397file
  • dsm01
  • embol-alexis
  • emeli
  • emissary
  • eomet
  • faith-dw1101
  • frito
  • ftp.bav-gw-beslan
  • ftp.brazen
  • ftp.ceai-wp
  • ftp.comneugonzu
  • ftp.easyway
  • ftp.hwapexc
  • ftp.javaman
  • ftp.myspirecu-customersvcs
  • ftp.postepay-verifiche
  • ftp.secure13citiweb
  • ftp.t2osrzoa1lg3u
  • ftp.user-verification
  • ftp.verify-accountlt
  • ftp.wcmmiczvxz
  • ftp.xluzevvaghob
  • galway
  • gamelan
  • google-cdn
  • graeub
  • guarneri
  • haram3
  • hassk
  • hd-dibteprug
  • hnskasmk005
  • hollis
  • homecomputer
  • imserver
  • inova
  • ipmc
  • isaac-mo1101
  • jahu
  • janes
  • jayden-cp1101
  • jivox
  • jjpetro
  • johnadamsy88b
  • jsrudhoqnv
  • judggalum.fenikos
  • jula6aos
  • juliacaroline
  • justi
  • kamera
  • kanat-lynix
  • kdgmcpwrgt
  • kliavhome
  • knmcbrplxb
  • ksbpmwypxx
  • kuroneko
  • ladany
  • lamozzarella
  • lddd
  • lemons
  • leosousa
  • lhnsqus
  • limitlesstsi
  • longmon1108
  • lucas040412tf
  • maadi2
  • macao
  • macs
  • madison-vi2503
  • mail.hiddleston
  • mail.pino
  • mail.v3-amazon-order
  • mbenet
  • meluvtinsxv
  • mens
  • merriamebster
  • mohammed
  • mojtaba
  • mouurniing
  • mrlasdobin
  • mtgl1104
  • mwpfcmlwoi5wr0y
  • myp0602
  • ncats
  • neospio
  • nicole-nd1501
  • nikon
  • note
  • novujfif
  • nuljjamq
  • nusonauyel
  • oatchen
  • oayixin
  • ojaf
  • oklahoma010212jw
  • oldherts
  • onc
  • openvpn-volgograd
  • pacific
  • pascal
  • photobook
  • pldxle
  • plume
  • protenchemar
  • pycniq-ontvang
  • qyipogoyagogi
  • raccoon
  • reespano
  • reiwheadoriperne
  • ricardodalcin
  • rofilsiky
  • rpm
  • rx34adams2q
  • rxsxnxkm
  • rzil
  • sachin
  • sascha
  • seat
  • shame
  • sputnik
  • squr0103
  • ssp59
  • swritextd26
  • swriteyig53
  • tests
  • tong
  • torreweb
  • tronofrapa
  • tsm
  • tuyenmr
  • tying
  • uavsxlnoxypg
  • unisolph
  • usinfo
  • ux20taylor3a
  • verify-delonefcu
  • verify-ecu
  • verify01-srpcu
  • verify77c-secure
  • verifyab03-securem
  • vermont-re0801
  • vg79.acc
  • vimosid
  • vozrazhdenie
  • vqiwi3un
  • vwzjxd
  • wcqibfgukx
  • webos
  • wewepoun
  • wilfred
  • wkcr
  • www.97h23c96
  • www.australiataxau
  • www.bjjpptlgvl
  • www.braille
  • www.buywathcesh1
  • www.cj50scott0k
  • www.david-port
  • www.dbz
  • www.email-yahooupdate
  • www.fargo84-secure
  • www.ferrorum
  • www.help-srpcu1
  • www.indigweorls
  • www.inf0-update
  • www.kqupupvutipewihg
  • www.master
  • www.myposte-postepay-verifiche
  • www.pdaetcinygcmy
  • www.perhei2507
  • www.re2americafirst
  • www.security-idcheck072
  • www.ssr
  • www.useracct-ecu
  • www.verify-vantage-westcu-member03l
  • www.verify-vantage-westcu-member05l
  • www.verify1account20
  • www.verifysecuresinfo02
  • www.wellsfargo-dataverify
  • www.williammitchellp99m
  • zihfl
  • zlhlalala
  • schepens
  • clientverify-citizenbanking
  • folt
  • ppdnepr
  • pqpqme
  • www.cibitung02
  • www.ordehere
  • cs.cspdnc
  • ftp.wv-frostbank
  • tetris
  • www.citz3ac
  • 883f95
  • abohallig
  • anthonymitchellm82f
  • bhfzlcykmu
  • ceatanebers
  • citizens1
  • ct30lewis0p
  • esuqu3uk
  • explanation
  • flavlessdrag
  • footgolf
  • fqc0402
  • ftp.bilog-vdi-04
  • ftp.blognancy155
  • ftp.kzqwudtaybrg
  • ftp.romaincarnac
  • ftp.update-del-oneactv2
  • ftp.vdsiryksyh
  • ftp.xca1-ch4a3-verification
  • hawaii-nv1201
  • henatimgex
  • hieezdifeesxxkfn
  • isaiah-ia1101
  • ittelecom
  • john-hm1101
  • justin19
  • mihai-anghel
  • myposte-securelogin-to-postepay
  • nfkhbinxk
  • nysits
  • pdfkuuh
  • phosre1306
  • prqza
  • robthey88prinjunc
  • sammy
  • se
  • sioterdefo2011
  • supavoxietwii
  • testlab
  • tj08lopez1w
  • vlinidbuxorarepx
  • widcuaet
  • www.gu7xe1vw
  • www.mg87kdaevq
  • www.michihome
  • www.ncsecu-org-onlinehelps
  • www.pong
  • www.verify-gifts
  • wyatt-uz1401
  • yorklee
  • zlav10
  • zltbprtkjv
  • 18z8mr0
  • 1w3972z
  • 3501
  • 3625
  • 7a7f2d0b4e
  • ad11robinson9v
  • alyssa-uk1301
  • americafcu
  • aocer
  • argon
  • arizona-cz1001
  • atuhuozeqk
  • barbara
  • barker
  • beam70121001
  • benefit
  • brawijaya
  • brycqnwcoi
  • camera52
  • cd49parker1c
  • cdj
  • ceb6rj32
  • chase-onlinemobile-security
  • chemogas
  • chenxinnuo.cnhk
  • christian-mt2906
  • christopher-ox1301
  • chryslerfuseboxmap-yen1205
  • clumol98wood
  • cuong
  • czoxebu
  • dan224streetradio
  • danielgarcia2005
  • dinhtienhoang
  • drzq13
  • dudaguia
  • dxeuastuuzjua
  • edc
  • espnet
  • evezi8em
  • fbsdi
  • fishbone
  • ftp.antipasto
  • ftp.cloche
  • ftp.ets
  • ftp.jamescarters36x
  • ftp.secure-usbank
  • ftp.siy48u
  • ftp.sys-route
  • ftp.thrd
  • ftp.vfwfa3v
  • ftp.yun
  • giomugecan
  • hawaii-rp0801
  • highosijlap
  • hkcun
  • hotmail
  • hvern
  • integrated
  • iuiry
  • jameshalls88s
  • jamie
  • jawdsop2706
  • jrotc
  • jsyuy
  • k.xserv
  • k1
  • kansasfarmer
  • karenblog069
  • kevinwhitex16r
  • kiddie
  • kuvvetmira
  • ljwjciexfwfiieex
  • location
  • lokee
  • lucole
  • lwqkcatabd
  • macquarie
  • mail.bei
  • mail.dealer
  • mayashopuc
  • metra
  • michael-jr0901
  • mississippi-jh1401
  • miusfuugzoilw5uo
  • mntban3in6
  • mobil95
  • ms
  • mtsowldy
  • mvabrothers
  • myetayi
  • nathan-wj0801
  • neo
  • nicole-vp1301
  • openboxhdtv
  • owen-hu0201
  • p2p
  • phoenix
  • planetanet
  • plusguidevl
  • porno-lidpe
  • postepay-verifiche
  • pp72brown8z
  • qryrehkxbesdvdplxtouort
  • queiawrfc
  • ramgraber
  • raoul
  • remoon2
  • resue
  • retjssew
  • roost
  • roseg
  • rowsoseatab
  • saugustus
  • sbox
  • secure04citiweb
  • selina
  • service.alex4fake
  • sfsu
  • simple
  • soha
  • sumy
  • svetlanacl.i1
  • swriteaqf90
  • swriteyba57
  • tabvingwica
  • tko
  • tnguyen
  • tpffurbx
  • trassir
  • tscnn
  • tu14hill6a
  • tw.linzhiyao
  • ua08carter2t
  • vafung-vpn1
  • varaporn
  • vault-morgothhome
  • verifyinfosecures-0
  • vpncisco
  • wertggf
  • wework
  • wopr
  • writeessccg32
  • writeesseqo32
  • wujiang.hkr
  • www.americafirsts-com
  • www.ayaya8im
  • www.brandonleethecrow
  • www.cf135
  • www.cxaoprcjthrooo
  • www.ehs
  • www.esoh1006
  • www.gp48gonzalez8g
  • www.hkm
  • www.l0azko1x3ug
  • www.lab1
  • www.mail-srv-64
  • www.oec7012
  • www.pharma
  • www.postalre-shipment
  • www.pubgm-event2019
  • www.verify-server3b
  • xavi
  • xcersea
  • xolomuxiphl
  • yuhoveb
  • yuledox
  • zgmxwsnzxhd
  • ziffusion
  • zm
  • cbar
  • claim-00036
  • dfidi3ul
  • ftp.verify-07
  • ftp.verify12logintv
  • galloway
  • in59white6p
  • qqowadkeiolooadr
  • sweetablasma
  • vg52.acc
  • www.secure003-verification
  • zerg
  • www.office365
  • www.ry37baker2m
  • ftp.avitan
  • guacamole.townyfunhouse
  • info05-account
  • mathd
  • ms-frostbank
  • ravshan
  • secure4c-auth
  • www.infoverify2bank-web
  • 79vvptm8v
  • afcuaccess-login
  • braston
  • ftp.branet
  • ftp.rychlik
  • glamticzucu
  • ihp
  • nc.soulary
  • pedregal
  • swritekio95
  • www.chaseonline-security
  • www.lucille
  • www.nitsche
  • 4340
  • 4602
  • amelmilti
  • anthonyrobertsd5x7
  • arsenal
  • besttivanlect
  • brin
  • buaodnioysslyioosc
  • bugzilla.developer
  • cclink
  • ceqdl
  • chase-bi1301
  • chase-secureid
  • clientennota-webnl
  • coeke3ex
  • davidjonesf46a
  • dczs
  • delreedefays
  • district-cc3001
  • dobetter
  • donserver
  • ecarassai
  • essaywrwct78
  • factura-tgf
  • ftp.derridjhanany
  • ftp.devcode
  • ftp.preparedness
  • ftp.privacy-cit-auth-us
  • ftp.rpoevcplzp
  • ftp.sanders
  • ftp.secure03b-chase3
  • fz96rodriguez4w
  • galtier
  • gqutuna
  • guideweston
  • gwrety
  • gz80mitchell9l
  • hetpraathuis
  • inferno
  • innodent
  • integer
  • ip.ericlee1994
  • iportal
  • irab1006
  • javaygoh
  • joplin
  • kayla-wd1401
  • legok
  • mailserver
  • mankato
  • marios
  • mika
  • mobilelegendskin
  • neuse
  • paylicma
  • pets
  • pichamon62222012
  • rdpalmer
  • reichhome
  • riumu5ox
  • rtech
  • rudos
  • sarphifollsound
  • secure07-info-verification
  • studio
  • swaet
  • swritektd17
  • tcs
  • tilinfulfci
  • ttcscekfmhnatdh
  • uqgsiqdtzlghr
  • utah-wb2202
  • vmaxd
  • warrenalpert
  • writeessslt44
  • www.ae35lopez1a
  • www.anna-db2606
  • www.dream
  • www.fdjor
  • www.l9mqdilyac
  • www.lumar
  • www.script
  • www.serviceupdate06q-authorizeinfo
  • www.soccer
  • www.taowebre
  • www.totaline
  • www.zjeya8um
  • xjmjykwmosddhbb
  • znequuazo
  • 031te3
  • 12306
  • 12race
  • 4ic14j6
  • 9elapl6y
  • accounts-ecu-helpandsupport02
  • acicero
  • added
  • ae2afcuonline
  • aqbxskcggid
  • auya
  • avrac
  • barca
  • beck
  • bewadefsa
  • cam3
  • cg
  • company
  • congraguihysri
  • csiganet
  • dakakipy
  • daper
  • directory
  • du50hall7l
  • e3leb
  • effects
  • emotion
  • enfostongper
  • epygwbnbr
  • essen
  • f1jrd
  • fabrybt
  • fakebilltuan
  • ftp.atlantiquebank-plc
  • ftp.cal45
  • ftp.chase-banks
  • ftp.dunchan
  • ftp.freematerialpubgm
  • ftp.kmoe8itu
  • ftp.mtveri2
  • ftp.penkokouro
  • ftp.pielicejor
  • ftp.swritedrx84
  • ftp.tn23allen7g
  • ftp.vantgwestcu
  • fysioportland
  • ga81miller1h
  • grinternet
  • guidemdf
  • hannah-jl1201
  • hog
  • icom001
  • ijiraa.nesplu
  • itbu
  • jb87lewis4o
  • kia
  • kimberly9
  • kundenportal-dkb
  • kz
  • kzbfio
  • lalaguna
  • linearal
  • lrt224-voo
  • luis-th1301
  • mail.dipped
  • mail.falsedad
  • maisongm
  • mangabeira
  • masterxx
  • megatek
  • mer6
  • minneapolis
  • mkvn
  • momo
  • mrpo
  • mubarak
  • pau
  • poste-aggiornamento-obbligatorio
  • pw31moore0n
  • qthedaiszgo
  • redacobamzsd
  • royalmail.com.rxs
  • rzh1bo
  • scotia
  • secure-del-oneactvtedit
  • sequel-laguiole
  • shinyeevee-dump-pack.flexec11cyccoy
  • slynet
  • szaboakos
  • talarn
  • tenverbfeststar
  • teto1
  • tice76miffbull
  • ugccja
  • vasto
  • verifu-urwell-x1
  • verify-account29
  • vhntzevuenr
  • videotohome.lmzly
  • www.10p18z
  • www.7i9sj
  • www.9e8p51
  • www.ae2afcuonline
  • www.aggiornamento-postepay
  • www.dedoes
  • www.emp00wer
  • www.fsbdds
  • www.gqsg10
  • www.joingrup-wa
  • www.login
  • www.rasqtaagxa
  • www.sdf23-well1far
  • www.tuannhung
  • www.valentin
  • www.verify-secureinf0s
  • www.verifyaccounty02
  • wxy3010
  • xluzevvaghob
  • zqqqsnskidecsc
  • zyxczyqlcg
  • verification-secureauth
  • phucyeulinh
  • ftp.del-one-userupdate02
  • ftp.gq-server
  • luckyspinpubg
  • www.jpmverifcation
  • 1coralgekas.kosar
  • 6430
  • 6789.a7ac49cceabd18f6
  • 6d1va9
  • 9zfr07
  • a012578493mid-hosting
  • aggiornamenti-portale-postepay-login2018
  • alexander-uy1201
  • alexvpn
  • anmt
  • appmail
  • asfert
  • audiocamp
  • azac8
  • baaby
  • babyshoppingoo
  • bills
  • br93thompson8t
  • circuits
  • claudinei
  • corpus
  • crisnet2
  • cryovac
  • dips
  • dygztsexoy
  • ertytu
  • escolavitare
  • ethan-wn0801
  • eunice
  • even-frefire
  • finewcscurrep
  • flextense
  • ftp.barrymore
  • ftp.fragilesleeveless
  • ftp.hxnh8
  • ftp.lustginkteto
  • ftp.qzlfedb
  • ftp.schokoladen
  • ftp.verify-secure07b
  • ftp.verifyusc-manage03
  • gadvopzeim
  • gavin-ph1001
  • gettysburg
  • gindt
  • giustihome
  • groth7
  • hannah-eu1301
  • hili
  • hucibono
  • i2
  • insertion
  • isabella-af1101
  • jjw
  • john-uy1101
  • johnrodriguezp66b
  • k12.gm-k
  • k3b7
  • ka04
  • kenin
  • kfc24
  • kraftwerk
  • kt8z36rwa
  • laguineareal
  • luci
  • majusculedemey
  • mane
  • massachusetts-op0801
  • meoraspucon
  • michihome
  • mosie
  • mt-secure05
  • nathan-zs1403
  • ncsecu-org-help
  • nebraska-wr2702
  • ning29151101
  • ntdqdyopbw
  • ntnjjbcuno
  • nwertytu
  • obfilkirstran1978
  • openwrt.c0wb0yhome
  • palone
  • paytm
  • phoebe
  • ponds
  • quelecdime
  • r-home
  • rezan
  • rjudeva
  • rkv1c
  • rlltoudkfg
  • ro3anthonyi62
  • s762
  • sbl
  • showing
  • soulx
  • sq11mwouyr
  • sully
  • sw1x
  • taxes
  • thcs
  • therviobachtinc1977
  • tninenagnder
  • twk
  • uti379
  • vb
  • viking
  • vilasa
  • what
  • wisiyuw
  • www.5o9l8oufw
  • www.alertscitizen
  • www.ecu-customer4
  • www.essaywrdjw20
  • www.itp
  • www.kdwjaivxneo
  • www.nganhangsub
  • www.poyawett
  • www.rabo-updateportal
  • www.samantha
  • www.securebanking
  • www.snowakalan
  • xzsa
  • zb20
  • zegob
  • zu61johnson1q
  • 0ax4o8
  • 1dismatopo.kosar
  • 4562
  • 4aenusso
  • 720p
  • 976ppja
  • api-mid-transferhosting01
  • austin-xa3003
  • cassa9
  • cisob
  • counselling
  • cpanel.userauth
  • cprdqpyubxy8xz
  • creed
  • csat
  • cuff
  • days
  • dbce3sxvvo
  • dvcchpowkstwmm
  • email-manager.guedes-project
  • enterprise
  • eragonet
  • firstbnking-fs
  • fmbrxbofeyahkby
  • freelancerdashboard
  • ftp.9082768
  • ftp.citizens1
  • ftp.dc55williams3v
  • ftp.join-grub-bokep
  • ftp.qlptopcrbbv
  • ftp.terganpluting
  • ftp.verifystart03-secured
  • gc3bd7c9
  • gora1sox
  • groupe-dejour
  • hadik
  • harmancsko2019900
  • indiana-nq1001
  • isaiah-ls3112
  • jgebitx
  • kbitqa
  • la0l2c
  • lomneoconsra
  • lsdccn
  • mahalan
  • mo91green5v
  • mulco
  • novel
  • nutnicha99153001
  • pharbthzei
  • qt2anthonyi88
  • radnet
  • raybanbrandsaleshopskm13
  • reexsiuzbeaoo9jh
  • rmfxzgibklb
  • ruthes4
  • sinfvadotthe
  • slavun1106
  • south-vc0801
  • spoilers
  • sr15smith3x
  • ssmile
  • swritedrq61
  • unimot
  • utah-ph1301
  • washington-di1001
  • water
  • wildticksitin
  • www.ascot
  • www.fraud-alert-secure
  • www.gems99
  • www.googlegroup
  • www.k24ujungberung
  • www.llum
  • www.secureinfosacount07
  • www.sidearse
  • zefik
  • zwsqgeyrjwpwn
  • 1000
  • eventfreefire
  • madison-js1101
  • mlm
  • mygov-ato
  • ojtivf
  • damih
  • ftp.shady487
  • portale-clienti-postepay-verificheonline-tbl
  • www.authwells3r5-verifycode5
  • www.help-secure-citizensbank
  • www.ndias
  • www.secureconnection20b-chase-verify
  • 0316vq1pi
  • 8h0d590
  • abuja
  • aerob.applecs
  • afcusignin
  • afifi
  • andrea-oo1401
  • anthonyrodriguezg3q4
  • azirsup
  • badu
  • bentley-am1001
  • boafgauqbaoqm9su
  • branch670023.fairstone
  • burrito
  • charlessmithe00t
  • circus
  • citizen-verify007
  • citzenshelp4
  • cpcalendars.groupwhtsappbokp.00
  • ecare7of
  • ftp.account-security-info
  • ftp.amethyst
  • ftp.citizensbank-help
  • ftp.verifyaccount-secure
  • gfhfx
  • guedesservidor1
  • ilalexar
  • info07-secure
  • iowa-fz1301
  • ip-cam
  • ipv6
  • jackson-mc1001
  • jackson-vt1301
  • jawhar
  • jayden-ro0901
  • jb70taylor7w
  • jj
  • jyui
  • jzkc0802
  • katherine-al1301
  • kb25allen7s
  • kbach
  • kdso
  • kovova
  • kr
  • loadingsgamesbr
  • melts
  • mokkosid
  • mymmomazoi
  • myogi9ab
  • niws915
  • oahaswak
  • odido-zakelijk
  • oscar
  • page
  • phantom
  • privacy-cit-en-sec
  • prnet
  • pumaqufawai
  • qbhmwy
  • qd
  • qretgadc
  • ra51nelson4c
  • securityverifyinfo
  • skini7ib
  • spinn
  • sure0053rd
  • swriteeix09
  • temporary
  • testejant
  • transmission.ingvarr
  • tugasnegara
  • tusisruf
  • ug-oel-amberg
  • vcocmirfbmh
  • vg11.acc
  • visiting
  • vvzzmprlba
  • wan1.mc
  • web-raboportal
  • werger
  • wisdom
  • www.home1
  • www.homeapi
  • www.jmzas
  • www.ncsecu-org-bankhelp
  • www.penkokouro
  • www.rmluk
  • www.ruriserx
  • www.stevenmillerg22o
  • xjq1003
  • 2030
  • 6108
  • 9b2364
  • acepm-ftp
  • add2netflix
  • alondra-hf1501
  • altelegcia
  • amazon1
  • americafirst-user
  • americas
  • armani1
  • at38clark8p
  • ayaya8im
  • azrael
  • betolobo
  • bibim
  • bptb
  • bqightwwlb
  • buime8ew
  • cam
  • campion
  • carpinus
  • cesslarli
  • chines
  • chosse21
  • christian-sg0801
  • coaka
  • coeur
  • csmx2
  • csqlxezf
  • cverifyco77-secure
  • dan223streetradio
  • dan43streetradio
  • danif
  • delaware-xu0801
  • delovoy.sname
  • deltaservice
  • dev2
  • devpax
  • dinskondvidmou
  • dktk
  • dmo
  • essaywroxw24
  • etdesign
  • eugene
  • ftp.assistancechsal
  • ftp.eddbenefits
  • ftp.frankh
  • ftp.gmmzleoqgveiqg
  • ftp.help-jshs
  • ftp.online-banking-secure-signinyurl2
  • ftp.secureaccount-applemanagesite
  • ftp.serve-user-verify04d
  • ftp.vantagewestuser
  • fz51green5n
  • georgia-ok1401
  • gfoqejyoiubieihx
  • gkb
  • help3448
  • hl48clark1f
  • isaac-jw1301
  • isidro
  • j331
  • jkiu
  • johnparkerv84l
  • josiah-lu1601
  • jsxfjs
  • k558u
  • kamila-sa0901
  • klu
  • km26
  • kwuzz
  • laresus
  • lincolnelectricalmap-jgb2808
  • lisco
  • mail.budha
  • mail.cruise
  • mail.disrespectful
  • mail.iehndikjfbsef
  • memorial
  • mpati0uh
  • mudonganh
  • ncc1701
  • nevada-fc1301
  • nod32.xyz
  • omstec
  • ovbrasoset
  • owen-qh1101
  • pampa
  • pbrihpmnleetvzd
  • phuccode
  • piigkihinu
  • pldvtnqe
  • puerto-mm1201
  • q8i96
  • racetrack
  • revit
  • rohde
  • salabuif
  • secu4-web
  • secure-dns-core
  • shoxx
  • silentium
  • simolbeih
  • swritefaf75
  • swritennp14
  • tcvetvvocit
  • tomah
  • tomica
  • turingtests
  • valagopfuc
  • vce1603
  • vdewsescwl
  • verify07dcase-secure
  • vguideon
  • vinzavod
  • vivint
  • vkb-eng
  • vvyat
  • wells-veri234fasoi
  • whiteserver
  • wpphe
  • writingbivph
  • www.1s0j7
  • www.a93to
  • www.bobistb
  • www.ennainode
  • www.fidtia0uthsec3ure
  • www.g4163
  • www.itemlangkah-free
  • www.lomneoconsra
  • www.memberassistdel1
  • www.o02s
  • www.securechase-verify0
  • www.storjnode3385
  • www.ueaqjoawweuvc1nc
  • www.verify-accountly1k
  • www.verifya53-logccb
  • www.vondermakelaardij
  • www.zdubcswbr
  • yyalebuvarini
  • zjkupgurng
  • www.ykjmy
  • homeserver.extern
  • mywel23fa1go
  • bluefire
  • citizensbank-onlinesecurity
  • ftp.digit-stcu
  • webmail.v2digit
  • www.mnt1
  • 24000-cardio
  • 42mmhar
  • 442862f
  • aggiornaora
  • alna
  • alyssa-sr1201
  • americanfirstslogin
  • ankithome
  • areamanager
  • asda
  • av37carter9x
  • ax38perez9v
  • bao
  • bav-gw-metallurgov
  • bennu
  • blackhole
  • bp45harris0l
  • carcapsule
  • christian-oh0201
  • citizensbank-auth-server
  • connecticut-da1401
  • dd-hochzeit
  • depression
  • diego-gu1501
  • essaywrgzk90
  • freeborn
  • fsc
  • ftp.billing
  • ftp.dalung
  • ftp.faojqqcbr
  • ftp.mephisto64
  • ftp.secure01-account
  • ftp.writeessohk83
  • fzuvkdugo
  • galritopmmint2511
  • gratinboxata
  • hiyokac
  • info-account07
  • japancars
  • jasonlewisj72n
  • jfagann
  • jikserty
  • leeds
  • linda8
  • ljamyjohp
  • ljhnosdmcj
  • lluca
  • lucho
  • mgldodfrp
  • monrasp
  • mvwdobetpelg
  • ncsecu-org-debit
  • nhanquavip
  • ninezero
  • novapark
  • redan
  • richardevansq01g
  • rt73gonzalez8d
  • rtr2701
  • s52gd3
  • saafi
  • sgzgutsiwv
  • siscom
  • ssh.trax
  • ssmel
  • support53-onlineprivacy
  • swriteuuf36
  • tomee-tp
  • trend
  • vercigdef
  • verify-53authunets
  • vmk03
  • wa23martinez3d
  • writeessxpy10
  • writeessyio83
  • www.afculink
  • www.dan12
  • www.illinihost
  • www.office
  • www.secure7bauthbank
  • www.secureauth
  • www.service-host-customer
  • www.ssml
  • www.studio
  • www.verify-occusec
  • www.vzmitrichenko
  • xk09miller8v
  • zucboejueahhtooq
  • 0815
  • 2pnfzs
  • 53rdonlinebankingenroll
  • 8g8u1iawn
  • abo98
  • absolute
  • adriana-ah1301
  • antipolis
  • arisara07202112
  • atagoutmu
  • atsumi
  • b5.b-hotels
  • bajiovujuqg
  • batuxzr
  • bi85king3x
  • bolden
  • bonafide02
  • brooklyn-uu1401
  • butter
  • cisneros
  • cloud.ugok
  • cobb
  • ctovar
  • cubrir
  • d1mkp95
  • dan27
  • david-dq2105
  • dgipi4uf
  • dirtvecol
  • essaywrkgu27
  • excel2.mem
  • fast80ip2
  • forumi0721
  • ftp.6222i7j
  • ftp.accountsupport-ecu004
  • ftp.graffitis
  • ftp.reloaqo
  • ftp.richardcarterr14f
  • ftp.secure-verify01
  • ftp.slava
  • ftp.verify2loginv3
  • ftp.verifylogin212
  • garlic
  • grace-jk0901
  • greyrock
  • guidevoicecm
  • hawaii-sg3012
  • iabu
  • in8
  • jackmas83irin
  • jaydenra
  • jeffnelsonh78k
  • jenniferu8
  • ju471914
  • k5wtwbmsu6t
  • kjcv8
  • ksidinamprot
  • le90p
  • lillian-ip1101
  • lolo
  • maisoncongis
  • michaeljacksonk09w
  • mingpo
  • mx72r0
  • nori
  • novella
  • np64thomas4z
  • ntech
  • ogurdppqgk
  • oklahoma-aw1501
  • ottoman
  • p6e92k
  • packages
  • peevi
  • people
  • phalcon
  • pnuti4es
  • pole
  • postepay-verifica-dati-online-cffsecurity
  • pregaratar1973
  • pubg-events12
  • pwky
  • qewaikloed
  • raphael
  • rtny
  • sdvr07
  • secur05d-auth
  • secureaccount-amazonsitepage1
  • shark
  • shes
  • shi
  • sideshow
  • skput
  • speedtest.sdlm
  • sshpi29
  • starseed
  • sukanya10060701
  • sweetconnection4u
  • tdsldtoeagsn43
  • thevel
  • urban
  • uyoyuposavrhidofdig
  • vg67.acc
  • vheo06qguunb
  • vueqnwl
  • vwnpzktzfjkcg
  • wan3.jiangxp
  • would
  • wrench
  • writeessfei70
  • writeessjli48
  • writeesspir43
  • www.2316b3250
  • www.apteka
  • www.bq1davidu30
  • www.citivalidate3n-signinaccess5h
  • www.essaywrcse47
  • www.fargo7zi2
  • www.foton
  • www.fury
  • www.ils
  • www.jiriliev
  • www.ks
  • www.levizanuxicufoz
  • www.maisnet-trayce
  • www.michaelkingy48x
  • www.mpb7155
  • www.ojuke3er
  • www.puntililat
  • www.servererrorsecure
  • www.v3rfyme
  • www.wc
  • xmaij
  • ygcypsg
  • zrumhbozz
  • asia2-nimble.gcwmi
  • branch650086.fairstone
  • cwt
  • erfyucoiojqk60
  • favynd
  • ftp.kolonyevi
  • listen
  • mq54edwards5m
  • mrzesty
  • u75j34r
  • www.jellyseerr
  • www.swritelxl45
  • yutej
  • zn73martin3m
  • euycmtssls0dx7g
  • 1mem.7stechnology
  • hoangcoder
  • igorarzhanov
  • info07-account-secure
  • intranet-lcya
  • verification-chase029b-securityhost
  • verify12-secured1
  • verifyyourinformationonline
  • www.overview-stcu
  • xtra
  • 1111
  • 11217
  • 1310
  • 24czcu
  • 2avk.w3ik
  • 4e1uzs3
  • 50wg8o
  • 661ge8
  • 7332
  • 7749
  • 8o0uqm6
  • 9juz405
  • abctelecom
  • accountdata3b-veri9fy
  • acted
  • adler
  • advyzagmpj
  • alanis-co0404
  • alyssa-ki0901
  • api-mid-transfer
  • aport
  • aqirstaral
  • aqu0802
  • artline
  • astrodrivers
  • b0rmwg4gub
  • barbarablog6813
  • bassinet
  • bbts
  • begovaya
  • bl94campbell4j
  • bn81clark5q
  • botox
  • bout
  • branch640680.fairstone
  • btyoaargfeaafwg
  • carlos-np0801
  • cf.wsbh
  • chata
  • cicomp97cyatit
  • commontrunk
  • constantinedev
  • crosse
  • cwiemann
  • dami
  • dan81streetradio
  • databyte
  • datacenter
  • dccsrud
  • dehio
  • directe-0ntvangster
  • download2976file
  • eiveylout
  • emporiocarrijo
  • exclsvoffers
  • ezequiel
  • falsstan79quiverbabb
  • famexgestion
  • ftp.antalya
  • ftp.birthstones
  • ftp.blockchain
  • ftp.excelfile-z3
  • ftp.formalwin
  • ftp.maggot
  • ftp.paomontmagny
  • ftp.tmonline-verification
  • gorgonzola
  • hahu
  • head
  • helpnet
  • himart
  • hxfzdivcnvl
  • hz57lopez1m
  • i2ucfue7z
  • i9vl9gvh
  • ibsuylpcmn
  • inebseno
  • itcan
  • iwankramer
  • jarvis
  • jazz
  • jg67lopez0b
  • josiah-dw1401
  • juan
  • judge
  • kinderlachen
  • kk27edwards0v
  • kurinami.novot
  • lannaserver
  • lilmhacarentan
  • luive6ov
  • maison-av
  • mtxiljh

Current DNS Records

A AAAA MX TXT NS SOA

117.158.69.91

n/a n/a n/a n/a n/a

Want useful, structured WHOIS and DNS data like this? Check out SecurityTrails

Raw Whois Results for 117.158.69.91

% [whois.apnic.net]
% Whois data copyright terms    http://www.apnic.net/db/dbcopyright.html

% Information related to '117.144.0.0 - 117.159.255.255'

% Abuse contact for '117.144.0.0 - 117.159.255.255' is '[email protected]'

inetnum:        117.144.0.0 - 117.159.255.255
netname:        CMNET
descr:          China Mobile Communications Corporation
descr:          Mobile Communications Network Operator in China
descr:          Internet Service Provider in China
country:        CN
org:            ORG-CM1-AP
admin-c:        ct74-AP
tech-c:         HL1318-AP
abuse-c:        AC2006-AP
status:         ALLOCATED PORTABLE
remarks:        service provider
remarks:        --------------------------------------------------------
remarks:        To report network abuse, please contact mnt-irt
remarks:        For troubleshooting, please contact tech-c and admin-c
remarks:        Report invalid contact via www.apnic.net/invalidcontact
remarks:        --------------------------------------------------------
mnt-by:         APNIC-HM
mnt-lower:      MAINT-CN-CMCC
mnt-routes:     MAINT-CN-CMCC
mnt-irt:        IRT-CHINAMOBILE-CN
last-modified:  2025-12-05T04:13:54Z
source:         APNIC

irt:            IRT-CHINAMOBILE-CN
address:        China Mobile Communications Corporation
address:        29, Jinrong Ave., Xicheng District, Beijing, 100032
e-mail:         [email protected]
abuse-mailbox:  [email protected]
admin-c:        CT74-AP
tech-c:         CT74-AP
auth:           # Filtered
remarks:        [email protected] was validated on 2026-03-23
mnt-by:         MAINT-CN-CMCC
last-modified:  2026-03-23T00:47:53Z
source:         APNIC

organisation:   ORG-CM1-AP
org-name:       China Mobile Communications Group Co., Ltd
org-type:       LIR
country:        CN
address:        29, Jinrong Ave.
phone:          +86-10-5268-6688
fax-no:         +86-10-5261-6187
e-mail:         [email protected]
mnt-ref:        APNIC-HM
mnt-by:         APNIC-HM
last-modified:  2026-07-31T13:46:41Z
source:         APNIC

role:           ABUSE CHINAMOBILECN
country:        ZZ
address:        China Mobile Communications Corporation
address:        29, Jinrong Ave., Xicheng District, Beijing, 100032
phone:          +000000000
e-mail:         [email protected]
admin-c:        CT74-AP
tech-c:         CT74-AP
nic-hdl:        AC2006-AP
remarks:        Generated from irt object IRT-CHINAMOBILE-CN
remarks:        [email protected] was validated on 2026-03-23
abuse-mailbox:  [email protected]
mnt-by:         APNIC-ABUSE
last-modified:  2026-03-23T00:48:02Z
source:         APNIC

role:           chinamobile tech
address:        29, Jinrong Ave.,Xicheng district
address:        Beijing
country:        CN
phone:          +86 5268 6688
fax-no:         +86 5261 6187
e-mail:         [email protected]
admin-c:        HL1318-AP
tech-c:         HL1318-AP
nic-hdl:        ct74-AP
notify:         [email protected]
mnt-by:         MAINT-cn-cmcc
abuse-mailbox:  [email protected]
last-modified:  2016-11-29T09:37:27Z
source:         APNIC

person:         haijun li
nic-hdl:        HL1318-AP
e-mail:         [email protected]
address:        29,Jinrong Ave, Xicheng district,beijing,100032
phone:          +86 1052686688
fax-no:         +86 10 52616187
country:        CN
mnt-by:         MAINT-CN-CMCC
abuse-mailbox:  [email protected]
last-modified:  2016-11-29T09:38:38Z
source:         APNIC

% Information related to '117.158.0.0/15AS9808'

route:          117.158.0.0/15
descr:          China Mobile communications corporation
origin:         AS9808
mnt-by:         MAINT-CN-CMCC
last-modified:  2008-09-04T07:55:15Z
source:         APNIC

% This query was served by the APNIC Whois Service version 1.88.48 (WHOIS-US2)


This page displays the publicly-available WHOIS data for 117.158.69.91, which belongs to an unknown organization.

Recently Reported IPs:

πŸ‡²πŸ‡½ 187.212.37.143
πŸ‡§πŸ‡· 181.189.68.228
πŸ‡·πŸ‡Ί 62.173.148.192
πŸ‡©πŸ‡ͺ 43.165.4.2
πŸ‡³πŸ‡± 213.176.26.144
πŸ‡³πŸ‡± 213.176.26.95
πŸ‡³πŸ‡± 213.176.26.51
πŸ‡¨πŸ‡± 179.8.199.235
πŸ‡©πŸ‡ͺ 172.70.248.134
πŸ‡ΊπŸ‡Έ 162.216.150.238
πŸ‡ΊπŸ‡Έ 154.28.238.174
πŸ‡ΊπŸ‡Έ 94.183.183.113
πŸ‡³πŸ‡± 45.148.10.120
πŸ‡³πŸ‡± 213.176.26.114
πŸ‡²πŸ‡¦ 196.92.7.246
πŸ‡¬πŸ‡§ 195.208.118.188
πŸ‡©πŸ‡ͺ 195.201.146.98
πŸ‡΅πŸ‡± 194.180.49.220
πŸ‡©πŸ‡ͺ 185.242.3.226
πŸ‡¨πŸ‡³ 183.227.86.239