AbuseIPDB » WHOIS 149.72.53.242
149.72.53.242 IP Address Information
| ISP | SendGrid, Inc. |
|---|---|
| Usage Type | Data Center/Web Hosting/Transit |
| Hostname | o1.sanasmtp003.sanastores.net |
| Domain Name | twilio.com |
| Country | ๐บ๐ธ United States of America |
| City | Las Vegas, Nevada |
o1.sanasmtp003.sanastores.net
Subdomains
- dekwbportal
- delinutstest
- dep-pipelines-beta
- darttoolgroup-prelive935
- rolanddgacorporationbeta3
- art-computer-live
- o1.scwesteurope
- prelive-gasbox-lv
- beta-voortman-us
- carvers-beta
- assets
- bollinger-diffusion-live
- eastbrook-live1
- rodogroup-live
- rotombelgium
- stringsthings-beta
- montte-beta
- pacificau-live
- repertoirecambodia-live
- dekwbportalbeta
- kunzi-beta01
- freshways-beta
- thermoprodukter-live
- fagron-be-prelive
- airsys-live
- pattberg-live
- caterlink-beta
- sunwarebv-live
- beta-gezellic-scientific-sapb1service
- ion-live
- maffioletti-beta
- berardi-live
- robertsc-live
- arentis-beta
- freefood-beta
- prelive-gasbox-lt
- logicwirelessliveshop2
- velu-live-sana92
- charge
- aloiskobernl-live
- avon-shop2
- beta-scc-hhtools-sapb1service
- nsw-beta
- plsfs
- fagron-hr-acceptance
- grupopromax-sapecc-beta
- hatwee-beta
- ppg-beta-products
- asmodeefrbeta-935new
- optura-beta
- gkl-prelive
- brustor-beta
- larson-juhl-anz-beta
- vanca-beta
- es-musicroom-beta
- ppg-beta
- weleda-betasana2018
- vedotec-beta
- crcindustriesttlive-au
- nds-beta
- okoliecentrale-live
- biosano-beta
- bollinger-diffusion-beta
- smartwares-live-byron
- saduntest04sanastore
- trewaudio-beta
- beta-scheidings
- building-plastics-live-93
- repertoireculinairefrlive
- forehand-beta
- integriah-beta
- akzonobel-ch-staging
- bandg-beta-sana93
- vanhage-live
- prasco-live
- anajet-beta
- quality-classrooms-beta
- bba-pumps-germany-live
- prinoth-beta-b2c-5040
- diamondbeverages-b2c-beta
- eepat-beta
- megafood-beta
- palfingerbeta-ssnamscc
- harryhers-live
- akzonobel-se-beta
- contiweb-live2
- prinoth-beta-ah-5010
- superauto-liveksb2c
- smitmaassluis9-b2b-beta
- berardi-live-shop2
- asmodee-live
- brinkman-pl-prelive
- haustechnik-beta
- foodex-live
- hydraulicworld-beta
- afpro-beta
- kraftwerkgroupag-beta-fr
- itsfs
- schlumberger-live
- aloiskober-beta
- amerock-beta
- dental-mdc-beta
- myaksapp03
- vjtech-live
- ch-musicshopeurope-beta
- rawlplug-live
- test-login-verdorenewables
- nasnzlive
- cmiharinascostaricabeta
- engels
- ipgphoton-beta
- kvg-live
- sfs-live-fr
- rawlplug-it-live
- musicroom-it-beta
- modernflamesbeta
- larson-juhl-europe-beta
- bandg-live-sana93
- drennansccmigrate
- fagron-us-prelive
- mommypaintbeta
- chanel2-beta
- distrimex-pumps-beta
- fastlydemo12
- pelicanrouge93
- pharvetlivescc
- prosafco-uat
- gymnaunip-live
- asmodee-spain-prelive
- fagron-de-test
- nl-musicshopeurope-beta
- rauch-live
- cendresmetaux-fr-beta
- blanclivescc
- fritzmassong-live
- medri-live
- ventabioksuperbeta
- swisslog-beta
- enetlogi-beta
- marketgrocer-live
- testshop
- palfingerlive-denmarkscc
- ravensburger-live
- fr-musicshopeurope-beta
- cimcool-cepl-live
- repertoirehongkong-live
- musicroom-de-prelive
- topaz-92-beta
- hermaprove-b2b-beta
- woombetaus
- vincent-sheppard-live
- akzonobel-uk-beta
- infinitypharma-be-prelive
- prelivetencategrassusw72emerald
- rolanddgacorporationbeta2
- united-pacific-industries-beta
- be-musicshopeurope-beta
- buffet-crampon-de
- cmiabacostaricalive
- diamondbeverages-beta
- visiodan-live
- scottlabsbeta2
- kunzi935migrationbeta
- jasaconv-beta
- boersig-beta
- carlisle-live
- companyshop-dev
- tectum-live
- globalfoodgroup-live
- lainnovacionbeta2
- palfingerbeta-swedenscc
- foodex-beta
- mdtrade-beta
- prinoth-live-it-5090
- stafil-live
- lived365-smartwares-live-princess-b2c
- redlangerthuiswonen-beta
- distribui-live
- nlz-integriabeta
- test-verdoshop
- gymnaunip-beta
- stringsthings-live
- surfaces
- zoller-kipper
- net-musicshopeurope-beta
- de-musicshopeurope-beta
- fagron2-prelive
- cmiharinashonduraslive
- kubiecc-live
- akzonobel-fr-staging
- cimcool-cegb-beta
- herba-beta
- pacificau-beta
- parseredmond
- fortress-beta
- afpro-de-beta
- cimcool-cesk-beta
- italicatessenbeta-ie
- elho-live
- darttoolgroup-beta935
- speedyproductshop2
- gmfloral-live
- hn
- tectum-beta
- veldemanbedding-beta
- buffet-crampon-jp-beta
- asmodeeblackfire-live
- jangeversb2blive
- leimholzh-live
- kornukolive
- ppg-kennet-beta
- akzonobel-no-beta
- sapeccautomationbetasccstore2
- scottlabslive2
- musicroom-beta
- fagron-hr-test
- jupiter-webtests
- clarkecdcbeta
- fagron-us-test
- steelandtube-beta2
- asmodeeno-staging
- betad365-smartwares-beta-se
- verdohorsebedding
- werfhekkenonline-live
- fagron-hr-prelive
- live-gravoxy-sapb1service
- fluidtech-beta
- live-scheidings
- tedtodd-beta
- naturespride-beta
- beta-gasbox-lv
- eastbrook-beta1
- jangeversb2bbeta
- nhp-australia-live
- weldwellbeta
- afpro-fr-beta
- nlz-integrialive
- marcantonio
- net-musicshopeurope-prelive
- edusa123-live
- dieselforwardbetastore2
- marree9-b2b-beta
- sapeccautomationbetasccstore4
- speedyproductbetashop2
- betad365-smartwares-beta-smart-servicecenter
- dpe-live
- integriah-live
- zephyr-beta
- akzonobel-dk-beta
- oletietze-dk-beta
- trsfs
- eastbrook-beta-roi
- palfingerbeta-emeamarketingscc
- gartner2022shop2
- etilux-beta
- smartwares-beta-princess-b2c
- abbeychart-beta
- grande-cheese-beta
- arentis-live
- cmiharinasrdbeta
- fernandgeorges-prelive
- nvsm-beta
- akzonobel-no-staging
- origo-beta
- acceptance123sanastore2
- berardi-beta-shop3
- companyshop-beta
- grandmedicineserviceslive
- itemwest-live
- lainnovacionlive2
- berardi-beta
- lakridslive-se
- textolbetatx
- coffeesupremebetashop2
- charge-dk-beta
- musicroom-fr-beta
- gmundnerb2cbeta
- palfingerbeta-ibericascc
- acuneeds-beta
- musicroom-nl-prelive
- cimcool-cede-beta
- tiho-beta
- intamarque-beta
- akzonobel-nl-beta
- dental-mdc-live
- ihllive93
- repertoireemirates-live
- jenowoodb-live
- dieselforwardupgrade2
- akzonobel-ch-beta
- krainmanufacturingliveb2b
- fagron-be-test
- coldsteel-beta
- acp-live
- smartwares-beta-tristar-eu
- bergtoys-beta
- prinoth-live-re-5050
- akzonobel-se-staging
- bba-pumps-usa-beta
- repertoirethailand-beta
- companyshop-live
- scottlabslive4
- ppg-puk-beta
- ssa-sporting-goods-live
- ppcinsula-beta
- secure-akzonobel-fr-staging
- searchlightelectriclimited-live
- pjptestupgrade
- prinoth-beta-fr-5030
- intertruck935-beta
- edusa123-beta
- net-choralmusicshop-prelive
- proril-pumps-beta
- ravensburger-beta
- darttoolgroup
- acceptance187
- kunzi-live03
- crcindustrieseuropebeta-uk
- bnlsfs
- livepowerbetascc
- fagronacc-ncus-live
- czsfs
- textol-systems-3
- nordlockbeta-ca
- zorgservicexl-prelive
- airsys-beta
- strootman-de-live
- vittoria-beta
- mdmcommerciallive2
- spuntini-live
- superauto-liveautox
- grupopromax-sapecc-beta-shop3
- mcwane-live
- cmiharinasgtlive
- bba-pumps-poland-live
- hydrilbeta2
- scottlabsbeta4
- copperantbeta
- o1.sanasmtp002
- steinemann935migrationbeta
- purio-prelive
- cimcool-cese-beta
- crcindustriesttbeta-au
- lived365-smartwares
- tunturi-live
- betad365-smartwares-beta-eu
- cxd-beta
- cortiba-beta
- nosfs
- mnf-beta
- united-pacific-industries-classiccar-beta
- duthoo-beta
- kunzi-live07
- prasco-beta
- addonsupport935
- florettes-beta-new
- marcvanwiemeerschbvba-live
- repertoireaustralia-live
- haustechnik-live
- scottlabslive3
- eepat-live
- fagron-it-acceptance
- superauto-liveks
- autolackburmeister-3cnord
- engels-beta
- robertsc-beta
- diesel-4ward-beta
- verosoftw-beta
- asmodee-belgium-beta
- secure-akzonobel-dk-staging
- face-ecom.esp-hub-s9-beta
- velu-beta-sana92
- feo-shop2-live
- kersten-beta
- ipgphoton-live
- kaka-acceptance
- asmodeefr-live935new
- beta-pmchydraulics-dk
- cimcool-ceit-live
- fagron-de-acceptance
- naturespride-live
- swisslog-live
- sesfs
- wijngo9-b2b-beta
- aas-live
- michelin-935-alpha
- palfingerlive-ssapacscc
- bata-93-beta
- uksfs
- ussfs
- ghdeulive-nz
- musicroom
- hortilux-beta
- frankfordcandy-live
- kiwitzbv-live
- kraftwerkgroupag-beta
- dpe-beta
- fleming-medical-uk-live
- maxtyre-live
- sv
- live-my-smart-menu
- akzonobel-dk-staging
- gmfloral-beta
- hti-beta
- live-de-exalto
- us-woomprelive
- bonehamturner-live
- cadco-beta
- idealprotein-beta
- williamtu-beta
- rituals-beta
- repertoirethailand-live
- spal-live
- beta-hhtools-sapb1service
- solarlog-live
- baraleinc-live
- betad365-smartwares-beta-es
- adventure-live
- brinkman-pl-beta
- ihlbeta93
- prinoth-live-ah-5010
- vidrieria-beta
- fastlycachedemo
- ravensburger-ch-beta
- globalfoodgroup-beta
- infinitypharma-be-acceptance
- saccheria-ps-prelive
- frontdoortest
- quality-classrooms-live
- oletietze
- orlightlimited-b2c-beta
- vandevelde-beta
- jimlawrence-sana932-beta
- face-s9-beta
- importacionessoarmasanastore2
- scottlabsbeta3
- seroogysc-beta
- grafityp-sana935-shop2-live
- ravensburger-fr-beta
- prelivetencategrassusw72fivestargolf
- cotaptest93
- cimcool-ceit-beta
- groot-beta
- mdmcommercialbeta2
- pehavo9-b2b-beta
- rolanddgacorporationlive2
- cmiabahonduraslive
- cmialimentosgtbeta
- eesfs
- gamkobv-prelive
- musicshopeurope-beta
- jupiter-addonlk
- clothworks-beta
- brinkman-de-beta
- harryhers-beta
- modernflameslive
- weleda-beta-sana93
- naturespride-prelive
- regent-beta
- cameloso-beta
- carpenter-live
- beta-qrailing-pl
- hobartsvc-beta
- cfitireservicebeta2
- marree9-b2c-beta
- neotherm-prelive
- sfs-beta
- vabnv-beta
- conorsports-live
- couk-musicshopeurope-beta
- spuntini-beta
- asmodeenl-edstore-beta
- cmiabahondurasbeta
- demac8010-beta
- hollu-live
- fernandgeorges-beta
- megagen-beta
- victussportslive
- bgc-live
- nordlockbeta-us
- secure-akzonobel-se-staging
- desfs
- asmodeestorefr-beta935
- cmiabagtlive
- sfs-beta-fr
- demaclenkobetabeta
- labelmasterlive
- polvo-live
- ppcinsula-live
- fidiversey-beta
- kindlimanscc
- columbusvegetableoils-beta
- verolub-live
- fagron-us-acceptance
- verdocatlitter-beta
- asmodeeno-live
- planlicht92-live
- crcindustriesttlive-nz
- bgc-beta
- brinkcamp-beta
- cortiba-live
- drrath-beta-sana92
- lived365-smartwares-live-camparttraveluk
- shadow-beta
- brinkman-de-prelive
- publicare-beta
- coldsteel-live
- fml-live
- ravensburger-poc935
- copagro-nl-live
- betad365-smartwares-beta-princess-b2c
- live-sgs-sapb1service
- fagron-acceptance-nl
- asmodeenl-edstore-live
- dehaske-beta81
- stamarpackaging-beta
- amerock-live
- gap-beta2
- rituals-test
- cmiharinasrdlive
- palfingerlive-emeamarketingscc
- brunswick-si
- dep-pipelines-live
- reagecon-live
- sig-s9-beta
- asmodee-beta
- verdorenewables-beta
- ch-hledealers-beta
- smartwares-beta-de
- frsfs
- spruyt-hillen-prelive
- vandenanker9-b2b-beta
- verdorenewables
- ppg-alamo-beta
- prinoth-live-b2c-5040
- musicroom-de-beta
- dev-eshop
- repertoirehongkong-beta
- it-musicshopeurope-beta
- kral-beta
- bdidirecsourcelive
- art-computer-beta
- vicsaperu-live
- apgsrl-beta
- vpt-live
- fortress-beta2
- tiho-live
- bowman-manufacturing-live
- pomabeta
- intertruck935-live
- betad365-smartwares-beta-tristar-eu
- santens-live
- nzl-integriabeta
- rochling-beta
- schlumberger-beta
- verabradley-beta
- dalebrook-beta
- orlightlimited-b2b-live
- aloiskoberuk-beta
- outimat-live
- autolackburmeisterlive-3cdeutschland
- feo-beta
- sarem-beta
- mommypaintlive
- larson-juhl-nz-live
- cmialimentosgtlive
- de-hledealers-prelive
- frontdooraustralia
- egmontbeta-sw
- distribui-beta
- keller9-b2c-beta
- mercalab-beta
- searchlightelectriclimited-beta
- werfhekkenonline-beta2
- comulsa-live
- fitnesshotline-beta
- www
- asmodee-italy-beta
- fagron-it-prelive
- 1210leitnerbeta
- d365etestdrive
- fagron-fr-prelive
- live-clark
- fisfs
- mercalab-live
- tcc
- contiweb-beta
- diginetlivescc
- kerasombv-beta
- mdtrade-live
- mteden-beta
- bba-pumps-live
- kaka-beta
- fastlydemo
- secure-akzonobel-ch-staging
- genesis-beta
- aqtor-live
- promena-beta
- grandmedicinepharmalive
- rituals-acc
- oaboliviabeta
- afpro-fi-beta
- aptcoinve-live
- testfcsaasstore
- hoorens
- megagen-live
- schaefer921-beta
- teknocalor-beta
- campbellsupply-beta
- cmiabacostaricabeta
- cimcool-cepl-beta
- rauch-beta
- molconinterwheels-live
- saccheria-fb-beta
- smartwares-betad365
- fagron2-beta
- casfs
- sportingid-beta
- sapeccautomationbetas4store3
- thpaints-nl-beta
- coulisse-newbeta
- ppg-live
- asmodeeblackfire-beta
- eastbrook-beta-ni
- carlocas-live
- ghdnz-eu-beta
- thermocomfort-beta
- prinoth-live-kk-5230
- robert935migrationbeta
- voortmansaasbeta-usa
- brinkman-int-beta
- dealerportal-nz-bla-fut
- nedap-beta
- buffet-crampon-us-beta
- jupiter-webapp
- ravensburger-nl-beta
- litesourceinc-beta
- secure-akzonobel-no-staging
- diginetbetascc
- qbs-live
- acella-beta
- beta-cysgroupeu
- ravensburger-us-beta
- hygiena-beta
- testhydroflask-beta
- fritzmassong-beta
- com-bandmusicshop-beta
- etilux-live
- myjoolz-sc-beta
- asmodeenl-beta
- cfdemo
- cmialimentosrdlive
- fagronacc-ncus-beta
- smartwares-beta
- delice-beta
- tetenaluk
- cimcool-cese-live
- fnac-live
- cimcool-cipnl-beta
- www.acceptance187
- superauto-liveautoxb2c
- tetenal-live
- freefood-live
- hydrilbeta3
- elpo-beta
- piwiktest01demo
- holzpichl-beta
- test-keracasa
- championpower-beta
- smartwares-prelive
- overgom-live
- versalert-beta
- nl-hledealers-beta
- another-jupiter
- iovatehealthbetasanainternational
- vanhage-beta
- motosyveh-live
- coffeesupremeliveshop2
- fagron-es-prelive
- fagron-prelive
- nl-choralmusicshop-beta
- bellon-live
- dobotex-beta-1
- dominopizza-live
- marshalls-beta
- okoliecentrale-beta
- diswaymoroccobeta
- cimcool-cefr-beta
- verolub-beta
- baraleinc-beta
- caterlink
- akzonobel-fr-beta
- beta-pmchydraulics-se
- grasdorf-beta
- sunwarebv-beta
- beta-clark
- crcindustriesttbeta-nz
- leimholzh-beta
- repertoireculinairedelive
- smartwares-beta-smartwaresinstallatie
- thiboonline-live
- trewaudio-live
- betad365-smartwares
- fagron-dk-acceptance
- valleyfloral-live
- polvo-beta
- asmodee-france-live
- mtee-beta
- lwflooring-live
- o1.sanasmtp003
- thermocomfort
- palfingerlive-germanyscc
- orlightlimited-b2b-beta
- beintronicsbetascc
- conorsports-beta
- thiboonline-beta
- bowman-manufacturing-beta
- beta-my-smart-menu
- logicwirelessbetashop2
- tccc-beta
- strootman-live
- vpt-beta
- marlowropesincbeta
- musicroom-nl-beta
- maxtyre-beta
- aloiskober-live
- palfingerbeta-germanyscc
- abboudtra-beta
- fagron-acceptance-sterile
- relianceb-live
- best-teleprodukter-live
- flowtrendlive2
- aloiskobernl-beta
- emax-beta
- mooijverf02-live
- eltrex-beta
- grupopromax-sapecc-beta-shop5
- elreka-live
- palfingerbeta-ssapacscc
- drennan-beta
- pregel-beta
- buffet-crampon-beta
- cimcool-cecz-beta
- sapeccautomationbetas4store2
- crcind-beta
- kavobv-live
- frederickgoldman-beta
- nl-hledealers-prelive
- sapeccautomationbetasccstore3
- prod-hhtools-sapb1service
- verdocatlitter
- ravensburger-be-beta
- heatletsdk
- sgtoolbox-beta
- autolackburmeister-alfaautolack
- nvsm-live
- ammeraalbeltech
- cmialimentosrdbeta
- vincent-sheppard-beta
- profiz-beta-sapb1service
- crcindustrieseuropelive-uk
- palfingerlive-swedenscc
- publicare-live
- rishitea-live
- ghdnz-beta
- michelin-alpha
- smartwares-beta-be
- molconinterwheels-beta
- werfhekkenonline-beta
- testerworldltd-live
- smartwares-beta-bodin-b2c
- harkema9-b2b-beta
- kraftwerkgroupag-live
- ppg-aquina-beta
- prinoth-beta-kk-5230
- textolbetads
- sarem-live
- beta-qrailing-us
- mtee-live
- brinkman-int-prelive
- airexbeta
- loginverdorenewables
- germanstore-beta
- nipon-beta
- akzonobel-uk-staging
- hobart-beta
- prinoth-live-fr-5030
- egeplast-beta
- reliance935migrationbeta
- testxyz
- bellon-beta
- admirallive
- victussportsbeta
- livepowerlivescc
- de-bandmusicshop-beta
- florettes-live
- jupiter
- mustad-benelux-beta
- outimat-beta
- slcanada
- 2pacific-beta
- currentbauerscc
- ets-beta
- weleda-beta
- htifreshsana930
- origoie
- united-pacific-industries-live
- hydraulicworld-live
- championpower-ca-beta
- foodandda-beta
- lived365-smartwares-live-eu
- lived365-smartwares-live-it
- sgtoolbox-live
- beta-qrailing-at
- championpower-live
- rahrcorpo-live
- at-musicshopeurope-beta
- jhfoster-live
- kvg-beta
- navigatorupgradebeta
- planlicht-beta
- ps-kb
- at-choralmusicshop-beta
- buffet-crampon
- scottandson-live
- repertoireculinairefrbeta
- sig3-s9-beta
- fagron-beta
- kaka-live
- actintronicsbetascc
- frederickgoldman-live
- live-cysgroupeu
- repertoiremacao-live
- domain2
- carpenter-beta
- cendresmetauxbeta-it
- diswaymoroccolive
- aloiskoberuk-prelive
- mustad-beta
- cmiharinasgtbeta
- jofemar-beta
- sde
- dealerportal-anzp-bla-fut
- etltechno-beta
- rawlplug-beta
- vidrieria-live
- foodex-live-b2b
- chamathtest
- secure-akzonobel-uk-staging
- harol-poc
- rolanddgacorporationlive3
- musicshopeurope-prelive
- asmodeeno-beta
Current DNS Records
| A | AAAA | MX | TXT | NS | SOA |
|---|---|---|---|---|---|
| n/a | n/a | n/a | n/a | n/a |
Raw Whois Results for 149.72.53.242
# # ARIN WHOIS data and services are subject to the Terms of Use # available at: https://www.arin.net/resources/registry/whois/tou/ # # If you see inaccuracies in the results, please report at # https://www.arin.net/resources/registry/whois/inaccuracy_reporting/ # # Copyright 1997-2026, American Registry for Internet Numbers, Ltd. # NetRange: 149.72.0.0 - 149.72.255.255 CIDR: 149.72.0.0/16 NetName: SENDGRID-149-72-0-0-16 NetHandle: NET-149-72-0-0-1 Parent: NET149 (NET-149-0-0-0-0) NetType: Direct Allocation OriginAS: Organization: SendGrid, Inc. (SENDG-12) RegDate: 2017-09-05 Updated: 2023-04-18 Comment: -----BEGIN CERTIFICATE-----MIICqjCCAZICCQDhy9sj6vfsITANBgkqhkiG9w0BAQsFADAXMRUwEwYDVQQDDAxzZW5kZ3JpZC5uZXQwHhcNMjMwNDE4MTMzMzE4WhcNMjQwNDE3MTMzMzE4WjAXMRUwEwYDVQQDDAxzZW5kZ3JpZC5uZXQwggEiMA0GCSqGSIb3DQEBAQUAA4IBDwAwggEKAoIBAQCtGUyzM6DYu3qWkA/6sQ6c3hqN6TBxb8momQXSRN+OLWQf1pDQ5AShxHMMr4wbwPZH6TM+ZeWD5tqS9gJ5t/ZaRBLMuoNQGmZVMNbBST/Ip0sUOVjUZlMX8nTuZkrB/4QdVZzyPQbvIBVArHZ8tFz+fPifvRaU7bv735nWXTaCdsWqyqalc8hriFm2cffkU/5iqbxbG5E0XHRVBpdU+OH2jz8N0tGv9UXS2rZnavsdw0ijatvArqP4yyCWu6A9rsm+WUPofWURD3bd4G9l+s9s4/sQnnUg9l43ge9DzXOONI2kwlGCyvrWrV8ehBZqdLlyUHVIejxxwvjbomwk9bexAgMBAAEwDQYJKoZIhvcNAQELBQADggEBAI/rX7FEJoh2AjmbBPvEOlRc7qcFLMUwFJMOLTxe/ba7R7ca/kfDTcC6E1EMeMcLK5KzQqj5OxJqXtoP95TB3ZTcegejNZgu991e32qkrh69LzWlFI04kR+siHFYPhtoaoHfqPGlP2U9Pv9rUWLjf4Am3+Vwh2w31zsJ1L2ntOArpzhHEr78ra27+l23+v0jyZt8+jl0/xv0tMHQ66GFGRTRO/mk7orOSGVJQ4U639GJym4cMDML+ETrN7pKvmA5Lhjn+cv29oUBiTP9Jrg2sP0VuI434ctYC6CX2NCcYfP419MUrOTkM0Md2vj65n6k/pr1DgnOeHbt1ehsVzONt8w=-----END CERTIFICATE----- Ref: https://rdap.arin.net/registry/ip/149.72.0.0 OrgName: SendGrid, Inc. OrgId: SENDG-12 Address: Twilio, Inc. Address: 1801 California Street Address: Suite 500 City: Denver StateProv: CO PostalCode: 80202 Country: US RegDate: 2012-06-14 Updated: 2025-06-12 Comment: http://www.sendgrid.com Comment: Comment: (888) 985-8363 Comment: Support hours: M-F, 7a-7p Mountain Time. Ref: https://rdap.arin.net/registry/entity/SENDG-12 OrgTechHandle: TALSM-ARIN OrgTechName: Talsma, Jack OrgTechPhone: +1-415-390-2337 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/TALSM-ARIN OrgAbuseHandle: ABUSE3074-ARIN OrgAbuseName: Abuse Desk OrgAbusePhone: +1-888-985-7363 OrgAbuseEmail: [email protected] OrgAbuseRef: https://rdap.arin.net/registry/entity/ABUSE3074-ARIN OrgTechHandle: TSNO-ARIN OrgTechName: Twilio SendGrid Network Operations OrgTechPhone: +1-888-985-7363 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/TSNO-ARIN # # ARIN WHOIS data and services are subject to the Terms of Use # available at: https://www.arin.net/resources/registry/whois/tou/ # # If you see inaccuracies in the results, please report at # https://www.arin.net/resources/registry/whois/inaccuracy_reporting/ # # Copyright 1997-2026, American Registry for Internet Numbers, Ltd. #
This page displays the publicly-available WHOIS data for 149.72.53.242, which belongs to an unknown organization.