AbuseIPDB » WHOIS 45.77.127.116
45.77.127.116 IP Address Information
| ISP | Vultr Holdings, LLC |
|---|---|
| Usage Type | Data Center/Web Hosting/Transit |
| Hostname | horizonpharmacy.talkrxsky.com |
| Domain Name | vultr.com |
| Country | ๐บ๐ธ United States of America |
| City | Los Angeles, California |
horizonpharmacy.talkrxsky.com
Subdomains
- adamsdrugs-pinelevel
- glenwoodmedicap
- leeandpicklesdrugstore
- loganhealthpharmacy-clinical
- medicap-altoona
- mitchellsdrugstore-downtown
- newberryexpresspharmacy
- pittsboropharmacyllc
- sanatogapharmacy
- smscpharmacy-shakopee
- themedicineshoppe-shawneetown
- thompsonspharmacy-newnan
- wecarepharmacy-stafford
- westchesterpharmacy
- ladner-drugs
- rvapharmacy
- cainsdrugstorepharmacy
- panamarx
- procarerx
- quisenberryrx
- stpeterscommunitypharmacy
- unioncommunitycare-waterstreet
- westmoreland-newalbany
- auburnpharmacy-omc
- christiansburgrx
- clintonpharmacy
- decaturdrugs
- familydrug-manchester
- laspalmaspharmacy
- macspharmacy-southpeter
- medicineshoppe-1956
- midmichiganchs-houghtonlake
- northcolumbuspharmacy
- thompsondrugsaddlebrook
- truepharmacydevine
- villageapothecary
- currydiscountpharmacy
- apteekpharmacy
- eurekapharmacy
- fivemin-kkv
- gatecitypharmacy
- hendersonvillehealthmart
- hinesstreetpharmacy
- kaleospharmacy
- medicarx-bloomfield
- medicpharmacyservices
- munseyspharmacy
- orangeblossomfamilyhealthcenter2
- parklandrx-greenville
- tanglewoodpharmacy
- tidewater
- valu-ritepharmacy
- williamsburgpharmacy
- bellsfamilypharmacy
- cornerstone-fayetteville
- coronaspecialtyrx
- crossroads-whiteville
- easycarerx
- globerexalldrug
- jaguarpharmacy
- kannonhealth
- machiasfamilypharmacy
- mainline-rx-somerset
- marcromspharmacy
- mecmopharmacy
- nassaupharmacyinc
- picocarerx
- solutionspharmacy-blacksburg
- springtownpharmacy
- tinrx-807
- vitalcareinfusionservices
- westerndrug
- woodmoorpharmacy
- rockymountainpharmacy-estespark
- blueearthdrug
- bristolpharmacy
- c-cdrugs
- cashwiserx-3004
- coliseumparkprofessionalpharmacy
- curexpharmacy
- everestpharmacyandmedicalsupply
- mitchells-pharmacy
- mobley
- okiespharmacy
- orchardsdrug
- preferredrx-fannin
- preferredrx-okatie
- rileys
- riverviewpharmacy
- rockcanyonrx
- scheurerfamilypharmacy-elkton
- sinksrx-belle
- summithealthpharmacy
- windhampharmacy
- wynnefieldpharmacy
- yeoldemedicinecenter
- sugarriverpharmacy
- economypharmacymuskogeewestside
- boonescreekpharmacy
- caredirectrx
- cowboydrug
- deluxepharmacy
- infinitypharmacy-nealst
- neilscompoundingpharmacy
- novaqhealth
- professionalrx-charlotte
- prontopharmacy4
- thriftymedpluspharmacy
- citizenspharmacyservices
- beardrugsofkittyhawk
- cwp-miamibeach-f504
- evansdrugs-lockwood
- expressmedpharmacy-2
- friendhealthpharmacy1
- greenhillpharmacy1
- jacksonstreetdrug
- kermitpharmacy
- mypharmacyandoptical-lexington
- rams-pharmacy
- thomastonprescriptionshop
- alfords-ky
- completecarepharmacy
- farmaciaplaza18
- fortwaynecustomrx
- haguepharmacy
- healthsourcepluspharmacy
- lincolnrx-ferndale
- manorpharmacy
- mcdougallsdrugcenter
- nbpharmacy
- romanpharmacy
- sav-morpharmacy-arcola
- stoneviewpharmacy
- summersrx-kearney
- tunicapharmacy
- dannysrx-oneida
- bearskinhealthclinicpharmacy
- charlieshometownpharmacy
- cherryspharmacy
- goodrichpharmacy-anoka
- harmonsdrugstore-robinson
- hickmanspharmacy
- lakesidepharmacy-oroville
- memorialwestoutpatientrx
- prosserpharmacy
- ranger
- save-ritepharmacy-prospect
- sinksrx-stclair
- soledadpharmacyandwellness
- unionpharmacy-newtonville
- westsidepharmacy
- drugco-nashville
- kattermanssandpointpharmacy
- michaelspharmacy
- prunellapharmacy
- ashevilleinfusionservices
- blountdiscountpharmacy-blounthospital
- delbartonmedicalpharmacy
- epitomerx
- familydrugmart-pearlriver
- healthparkrx-raleigh
- hikmapharmacy
- mainstreetdrug-wilburton
- nucara-austin
- omakpharmacy
- parkwaypharmacy
- preferredcherokeepharmacy
- prescriptioncenterpharmacy
- primishapharmacy
- rivertonpharmacy
- save-ritedrugs-radcliff
- sbpharmacy
- summersrx-bluesprings
- volunteerpharmacy
- rxvip
- fullertonmedicalpharmacy
- greenwaypharmacy
- soundshore-mtvernon
- tri-areacommunity-laurelfork
- beebefamilypharmacy
- carolinamountainpharmacy
- churchillpharmacy
- citydrug-nys
- expressrx-bartlesville
- familydrug-columbiana
- heritagepharmacy-kingfisher
- pattersonkeyrexall-salina
- penobscotcommunityhealthcare
- thepickwick-pharmacy
- candlewooddrugs
- wellnessrx-compound
- 4frontpharmacy
- apothecarepharmacy-elizabethtown
- avitapharmacy-greenvalley
- bainbridgepharmacy
- baptisttowerpharmacy
- belmontuniversity
- boydsfamilypharmacy
- harvestdrugandgift
- hometownpharmacyofzachary
- korupharmacy
- lakewoodpharmacy
- lonestarcompoundingpharmacy
- phillipsdrug
- pruettscutraterx
- realodrugs-smithfield
- sav-ritefamilypharmacy
- shermansapothecarypharmacy
- sykespharmacy
- advancedhealthrx
- cwp-east-postorange
- durancentralpharmacy
- hersheycaremennonitevilla
- preferredrx-vancouver
- rampharmacy
- rapidaccesspharmacy
- relionpharmacy
- sandrdrug-jasper
- seeberspharmacy
- stmarypharmacy-northridge
- transit-hill-temp
- watchcitypharmacy
- linkpharmacycorp
- adamsdrugs-south
- akronhealth
- archerclinicpharmacy
- bereadrug
- catoosafamilypharmacy
- clinicpharmacy-cynthiana
- dolcrx
- fredoniapharmacy
- libertydrugandsurgical
- sheridanexpresspharmacy
- siglerrx3
- sinaipharmacy
- ucfstudenthealthservices
- unitedhealthcenterspharmacy
- villagerx-rockypoint
- warehousepharmacy
- zebulondrug
- westsidehealthmartpharmacy
- eastlakepharmacy
- avitapharmacy-fresno
- cape-hopemills
- gatewaypharmacy-bismarck
- hazletpharmacyinc
- jamesdrugstore
- pbccpharmacy
- primaryplusmaysville
- somcpharmacy-maincampusemployee
- southbaltimorepharmacy
- thedrugstore-kernville
- vitalcareofportland
- omaktribalhealthcenterpharmacy
- bakerexpresspharmacy
- dilworthdrug-charlotte
- hubspecialtypharmacy
- jelksfamilyrx
- kexrxpharmacy-fallscity
- lccpharmacy
- officepracticeofpharmacy
- onealsfamilypractice
- picayunedrugnorth
- robertsdrugstore
- rochelledrug
- sikestonmedicenterrx
- spotswoodpharmacy
- vidorfamilypharmacy
- wallshealthmart
- avitapharmacy-charleston
- doubleoakmountainpharmacy
- heartland-arkadelphia
- irwindrug
- keystonepharmacy
- loyaltypharmacy
- multnomah-rockwood
- oldtownrx-piercecity
- smithsdrugsofforestcity
- theowlpharmacy-southway
- thepharmacyattghs
- trianglepharmacy-mountaintop
- vcarepharmacy-chestnuthill
- walldrug
- thecornerdrugandwellness
- kirbyrxonmarket
- gracecarepharmacy
- avitapharmacy-houston2
- blackoakpharmacy
- cwp-millake-f516
- laboticarx
- mastfamilydrug
- ranchoparkcompoundingpharmacy
- sigmapharmacy
- augustahealthprescriptionservices
- gastonfp
- medicalplazapharmacy
- metcarerx
- ocontofallspharmacy
- sterlingspecialtypharmacy
- sweetgrass-carolinapark
- theblairpharmacy
- villagedrugco
- turnagedrugstore
- altituderxllc
- avitapharmacy-laredo
- bodedruginc-vienna
- caldwelldiscountdrug
- edsnellspharmacyshop
- familycarespecialtypharmacy
- fivepointscooperativephcy
- gulfbreezeapothecary
- med-worldpharmacy
- medicalpharmacy-zachary
- medtimerx
- monahanspharmacy
- mosheimmedicineshoppe
- rushmorecompounding
- stilwellpharmacy
- thriftwayflatbushavedrugcorp
- univofkansas-bellmaincampus
- winnwaypharmacy
- applerx-whittier
- austincompoundingpharmacy
- cypresspharmacy
- essexcarepharmacy
- familymeds
- fivemin-callcenter
- granitepharmacy-missoula
- maggypharmacy
- medicinemarketcompoundingpharmacy
- medicineshoppe-hesperia
- salinasrx-harlingen
- sinksrx-iberia
- somcpharmacy-waverly
- stuartspharmacy
- apexpharmacyandhomecarecenter
- becksdrugs
- everestpharmacy
- soulandbodypharmacy
- avantpharmacy-dallas
- bloomfielddrugstore
- greenhillpharmacy5
- hometown-madras
- mainstrx-savannah
- medicineshoppe-pleasanton
- midcountypharmacy
- moonsdrugstore
- omnifamilyhealth-chester
- rockytoprx
- sharpsburgrx
- spencesmedicalcenterrx-lakejackson
- stanleyrxcompounding
- thurmanspro-medpharmacy-mountpleasant
- tri-areacommunityrxatfries
- vowuniversity5
- westmontpharmacy
- yorkhospital-apothecary
- gooddaycentralfill
- magnumcompounding
- browndrug-pittsfield
- 360infusioncenter
- ahf-uat
- betterlifepharmacy-westny
- boltonhealtmart
- campbellspharmacy-seagirt
- cheekandscott-jasper
- citizenspharmacy
- cookspharmacy-shavertown
- corepharmacy
- frenchspharmacy
- ncapharmacy-commercetownship
- panamarx2
- patelinc
- r-excellence-man
- rubyspharmacy
- syslog
- watsonville-ca
- hammerlanerx
- micromerchant-eprimerx-test
- oneillfamilypharmacy
- palacedrugstore
- theclinicrxpharmacy
- wynnspharmacy
- avitapharmacy-la-1001
- brightonhealthmartpharmacy
- jordanvalleychc-lebanon
- oldtownrx-monett
- rawhidedrug
- ritecarepharmacy
- sandersvilledrugco
- tamarackpharmacy
- wolfriverpharmacy
- wyomingdrugs
- pharmacyhomecare
- pioneer
- arnolddrugco
- digital-betterlifepharmacy-westny
- hjohnsonpharmacy
- judysdrugstore
- nanticoke
- paramuspharmacy
- ratonmedicineshoppe
- rowleypharmacy
- rxatwellington
- westoncountypharmacy
- sellersvillepharmacy
- adamsdrugs-wetumpka
- alexapharmacy
- clarkspharmacyofsaltville
- crescentcenterdrugs
- deltadruginc
- hubbardyoungpharmacy
- invictuspharmacy-rochellepark
- luxemedcompoundingpharmacy
- medicap-8438
- medstoppharmacyandsurgical
- pinepharmacy
- thomaspharmacy
- blosspharmacy
- cookevillemedical
- delrayshorespharmacy
- downeydruganniston
- fivemin-kalihi
- franklinpharmacy
- lowcountrypharmacy
- medicinemanpharmacy-valley
- rosauerspharmacy-26
- scriptshoppharmacy
- test-ivr-6
- totalcarepharmacy-baconton
- u-saveitrx-palmyra
- uniteddiscountpharmacy2
- unionpharmacy-belmont
- cedarspringspharmacy
- expressrx-union
- greatplainspharmacy
- greenfieldpharmacy
- hawthorne-camden
- leescreekpharmacy
- masspackpharmacyservices
- orangeblossomfamily-homeless
- rightwaydrug
- rileydrugs-geneva
- starpharmacy
- truecarerx
- u-saveitrx-claxtonhobbs
- u-saveitrx-clayton
- wardspharmacy
- allentownpharmacy
- brighamcommunityrx
- cobornsrx-2037
- cornerstonedrug
- cwp-plaza-linda-cb56
- cwp-scongress-f517
- daniels-blackville
- genscriptsadminoffice
- highstreetpharmacy
- ludsrx
- royalpharmacy-broadway
- toplinepharmacy
- apothecarepharmacyv-elizabethtown
- avitapharmacy-orlando2
- camdendrug
- citydrugpharmacyandgifts
- communityhealthandwellness
- customprescriptions
- expressrx-trumann
- lifetimepharmacy-aubrey
- littlesilverfamilypharmacy
- pharmacarefloralarx
- sagerx
- victorymedicalcenterrx
- freedomhillcommunityhealthcenter
- hometownconnectwest-louisville
- avitapharmacy-dallas
- carlsdrugstore
- colonialvillagepharmacy
- communityhealthnetrx
- curtispharmacy-carmichaels
- greenhealthpharmacy
- herolds-northcharleston
- mactpharmacy
- medi-wisepharmacy
- medicalpark-rockingham
- prescriptionstogo-1
- test-de
- torresfamilypharmacy-raymondville
- aftonpharmacy
- fridayharbordrug
- hometown-carrollton
- hometownpharmacy-trinidad
- imperialbeachpharmacy
- mandspharmacy
- rpc2bpharmacy
- rxmartpharmacy
- sandbdrugs
- bandyspharmacy-trenton
- chinovalleyrx
- empirepharmacy2-melbourne
- fairwaysav-mordrugs
- rxclinic-charlotte
- thumbbutterx
- longpointpharmacyrx
- acaciaapothecaryandwellness
- avitapharmacy-newyork
- bellin-health-meds-bellevue
- bestvaluedrug
- communitycareclinicofrowan
- downtowndrug-watertown
- fastandfriendlyrx
- hayatrx-15
- hudsonviewrx
- jamesandwilkspharmacy
- kcpharmacy
- latimerspharmacy
- mohrmannsdrugstore
- perkinsrx
- pratersrx-sarcoxie
- shawsvillepharmacy
- sprucemountainrx
- u-saveitrx-ogallala
- whitebluffpharmacy
- boydsdrugrxexpress
- hawthorne-laurel
- hometownpharmacy-ravenva
- keansburgdrugs
- medicineshoppe-oneida
- neilspharmacyinc
- nucara-northbranch
- riversidepharmacy-yubacity
- saenzmedicalpharmacy-eastridgerd
- storyroadpharmacy
- tigerpharmacy
- toledopharmacy
- monumentpharmacy
- hartzellspharmacyinc
- avitapharmacy-louisville
- burnspharmacy
- cherokeepharmacy
- expressrx-hebersprings
- firstcarepharmacy-dayton
- goodykoontzdrugstoreinc
- healthmartrx-bennington
- hillstonepharmacy
- larkinpharmacy-biscayne-miami
- martinspharmacyofchristiansburg
- medicap-8043
- themedicinecabinet-alexandria
- thriftdrugs
- villagepharmacy-bessemer
- centennialrx-bridesburg
- innovarx-iv
- noblesvillelowcostrx
- pelicandrug
- pkscompounding
- realodrugs1
- sierrablancapharmacy
- smarthealthpharmacy
- summitcarepharmacy
- familyhealthcenterpharmacy-paterson
- abramsroyalpharmacyii
- bayoupharmacy
- blountdiscountpharmacy-west
- bryanpharmacy-southside
- burtspharmacy-westlake
- butlersapothecary
- customcarecompounding
- harlesscenterpharmacy
- horizonhealthpharmacy
- mtvernonrx-cathedral
- polemountainrx
- randmfamilypharmacy
- stonegatepharmacy
- testivr2
- thepillbox-springcreek
- usmedicalsupply
- viselspharmacy
- villageprescriptioncenter
- adamsdrugs-vaughnrd
- apothicare360
- boroparkpharmacy
- friscopharmacy
- hugotondrug
- maidendrugcompany
- medonepharmacy-boonsboro
- millershealthmartpharmacy
- save-ritedrugs-brandenburg
- thedrugstore-crystalfalls
- wilsonwil-savpharmacy
- medicinemart-aiken
- baldrockpharmacy
- accokeekdrugandhealthcare
- centralvalleycommphcy
- five-min-alamoana
- jandmdrug-homeland
- kubatrx-south
- maplemountain
- medicorxspecialty
- pharmacyplus-barry
- plazapharmacy-thousandoaks
- twincitypharmacy
- wheelspharmacy
- wireguard
- youfirstpharmacy
- avitapharmacy-arleta
- cambriadiscountdrug
- cornerstonepharmacyjfk
- delta-hollywood
- fitzgeraldspharmacy-williamsburg
- flagpharmacy
- harbordrug-deckerville
- liveoakpharmacy
- medicineshoppe-clovis
- medicineshoppe-orinda
- montezumadrugcompany
- northolmstedlowcostpharmacy
- oswalds-pharmacy
- turnersfamilypharmacy
- ulmerpharmacy
- wolvesdenpharmacy
- seminolepharmacy
- cobornsrx-2032
- mainline-rx-portage
- palimomimedicalcenteroutpatientrx
- pharmacyplus-winchester
- thefriendlypharmacy
- thepharmacia-washingtonmill
- townelakefamilyrx
- windhamrx
- wesleysdev-fluent-three
- buxhealthcare
- boydsdrugmart-east
- conwayseastsiderx
- harveydrug
- huntersspecialtypharmacy
- jandjpharmacy
- lynnspharmacy
- milwaukeepharmacy-2
- oakleyhealthmart
- pharmacyplus-paterson
- pilgrimpharmacy
- provisionpharmacy
- stocktonrx
- tallmanspharmacy
- thompsonstownstreetrx
- u-saveitrx-woodbury
- villagerx-ellsworth
- clabaughpharmacy
- omnifamilyhealth-fresno
- riverwalkpharmacy
- avitapharmacy-satx-1076
- bankspharmacy
- citizenpotawatomination-east
- doughertyspharmacy-forestpark
- kelbelpharmacy
- metcalfedrugs
- miguelspharmacy
- orchardpharmacy
- poolespharmacy
- sheldonpharmacyofyale
- talkrxconversion
- vitalcareofcollegestation
- youroakridgepharmacy
- medicineshoppe-838
- arcadiafamilypharmacy
- communityhealthcare-hilltop
- holleypharmacy
- lakesiderx
- martellaspharmacy-windber
- mountshastapharmacy
- northfloridapharmacy-oldtown
- oceanshoresrx
- owlhomemedical
- reddoorrx
- rockpharmacy
- silvertonpharmacy
- tomahawkrx
- avitapharmacy-1071-washington
- avitapharmacy-wiltonmanors
- fairmontpharmacy
- gooddayrx-yuma
- hometown-beavercreek
- ipsectest2
- medicalcenterpharmacy-midland
- pharmacyplus-passaic
- rileysrx
- thunderdrug
- carrolldrugstore
- doctorscenterpharmacy
- harrysrx
- kinesfamilypharmacy
- nwmedicationmanagement
- wellspacehealthrx
- genscripts-tulsa
- pennscarefamilypharmacy
- midwestcompounders
- vitalcareofirvine
- buntespharmacy
- carrollrx-trussville
- chcoftheblackhills
- keymedicalcenterpharmacy
- lafamiliapharmacy
- landmpharmacy
- medicap-meridian
- medicineplus
- milwaukeepharmacy
- nucara-westunion
- pacificcompoundingpharmacy
- pharmcare-tn
- saenzmedicalpharmacy-lindberg
- southendpharmacy
- villagecompoundingpharmacy
- drugco-littleton
- hardingroadpharmacy
- hendersonvillepharmacy
- hightidehealthcare
- hometown-roseburg
- kanzapharmacy
- mosersu-saverx
- nikkis-hometownrx
- nucarahomemedical-coralville
- onesourcerx
- pharmacycare
- pointepharmacy
- savcarepharmacy
- southsidepharmacy
- tanglewooddrugstore
- valumarketrx-mtwashington
- duffeydrug
- lindsaydrugco
- medicap-8057
- pawpawvillage
- pinnacleapothecary
- super1pharmacy-35
- hayatrx-30
- avalondiscountdrugs
- purescriptscompoundingpharmacy
- adamsdrugs-medicineontime
- annapolisprofessionalrx
- camascenterclinicpharmacy
- congressstreetrx
- creightonuniversitypharmacy
- eagledrug-winters
- harrisfamily-tn
- hironsdrug
- hometownpharmacy-specialty
- lifelinecmopharmacy
- medicappharmacygreenfield
- mirx
- noconapharmacy
- pinebrookrx-3
- travs-u-saverx-osceola
- vitalcare-coralsprings
- alliancecommunityrx
- contigocompoundingandinfusion
- dandhdrugstore
- eltejonpharmacy-frazierpark
- familyhealthcenterrx-orangeburg
- hwy69southfamilyrx
- kirks-hartland
- knollwoodpharmacy
- marketplacerx-littlerock
- medicinemartpharmacy
- medicineshoppe-1974
- pomeroypharmacy
- thepharmacieshoppe
- tomsfamilypharmacy
- vitalcareofscranton
- riesbeckspharmacy-stclairsville
- wellpackpharmacy
- alanspharmacyofstillwater
- cannonrx-concord
- familycarerxpharmacy
- greenwoodpharmacy
- realodrugs3
- stoneshealthmartpharmacy
- charlesrivercommunityhealth-2
- cobornsrx-2023
- delta-eutawville
- depietrospharmacy
- dundeepharmacy
- humana
- mobilityplus
- rickerpharmacy
- sinksrx-cuba
- valudrug
- wellness1rx-kettering
- westtownepharmacy
- carsondrug
- hiersdrugstore
- henryspharmacyllc
- lc-familyrx
- minipharmacy
- vowuniversity7
- ihs-jamestown
- compoundingpharmacyofgreen
- cornerstone-lakewood
- harmonsdrugstore-palestine
- larrysfamilypharmacy
- medicinestop-i
- niespharmacyandwellness
- okmulgeediscountpharmacy
- omnifamilyhealth-niles
- potterdrug
- prestonpharmacy
- richard-test
- southloupcommunitypharmacy
- valeroadpharmacy
- watkinspharmacy
- medicineshoppe-jamestown
- bufordpharmacy
- addisondiscountpharmacy
- allsaintspharmacy
- bridgeportcommunitypharmacy
- clarx-tennessee
- dorisisonrx
- healthheropharmacy-unasource
- healthyway-cedarknoll
- kooncedrug
- lavitacompoundingpharmacy
- lifecarepharmacyuvalde
- medicineshoppe-liberty
- rosauerspharmacy-33
- towntotalcompoundingcenter
- woodspringspharmacy
- brewsterpharmacy
- cornerdrughealthmart
- crawforddrug
- cwp-anderson-1d22
- evansdrugs-sunrisebeach
- halfmoonbaypharmacy
- heartpharmacy
- petscriptspharmacy
- romapharmacy
- summersrx-warrensburg
- wesvowutils
- accesshealthpharmacy-mabscott
- bienestarrx
- cornerdrug-melbourne
- healthsmart-claremont
- keycompoundingpharmacy
- ralphsthriftwaypharmacy
- rosvoldpharmacy
- southeastpharmacy
- tompkinsvilledrug
- westendpharmacy-loganville
- healthpropharmacy
- villagerx-miami
- centralohiocompounding
- basindrugs
- bellin-health-pharmacy-denmark
- communitypharmacyofrockwellcity
- cwp-palmsprings-f515
- familyhealthcenterpharmacy
- geringu-savepharmacy
- hayatrx-7
- kexrxpharmacy-hiawatha
- medexpharmacy
- moserpharmacy
- proscriptpharmacy-fresno
- shriverspharmacy-compoundinglab
- starwoodpharmacy
- summersrx-boonville
- tinrx-809
- villagerx-fayetteville
- vitalcareofportland-me
- realohealthplex
- familyhealthcarecenterrx
- hayatrx-11
- hinaspharmacy
- millingtonpharmacy
- modnurprescriptionpharmacy
- pharmpedia
- pricefamilyrx
- redspringsoldmainpharmacy
- savemartpharmacy
- bozemanchppharmacy
- clinic-durham
- cwp-plantcity-1b42
- familyrx-humbolt
- lifechangerx2
- marengopharmacy
- marinadelraypharmacy
- simplypharmacy
- talleylaw
- tdpharmacy
- univofkansas-southlakeretailrx
- utoledoedu-test
- bayviewsrcpharmacy
- bigcdrugs-skyline
- bvdrug
- crawfordspharmacy
- wesleystestpharmacy
- adelaideapothecary
- custommedicorx
- mcbainfamilyrx
- medicap-parma
- medlifepharmacy
- mypharmacy-orangeburg
- omnifamilyhealth-oswell
- pillboxpharmacy-willard
- redspharmacy
- southforkpharmacy
- ranchopharmacy
- sunlifepharmacy-florence
- arundelmillsrx
- clarksonpharmacy
- gosnelldrugs
- lambertdrugstore
- medcare-clover
- medi-expharmacy
- newalbanyrx
- theprescriptionpad-monticello
- unionpharmacy-needham
- waconiaclinic
- goltzpharmacy
- kershawfamily
- pillboxmodesto
- fop
- advancedrx-paincare
- belmontpharmacy
- cape-girardeau
- cobornsrx-2007
- fairfaxpharmacy
- magnoliadrugcoinc
- medicinemartpharmacy-rosewooddr
- nucara-peterson-mtnlake
- portervillepharmacy1
- pranacarepharmacy
- westfieldpharmacy
- 986specialtypharmacy-2
- accesspharmacy
- elkandrug
- familyrx-hampstead
- heartofflorida-central
- irmodrug
- smithpharmacy
- unionpharmacy-ma
- cannonrx-morrocroft
- comanchecountymemorialhospital
- elydrugs-glasgow
- fivemin-nanakuli
- medchoicepharmacy
- professionalpharmacy-wichita
- steinhatcheedrugs
- sunlifepharmacy-maricopa
- villagepharmacy-cambridge
- youngsrx
- aandbsunsetpharmacy
- docspharmacy
- downhomepharmacy
- equilibria
- knipperx
- rinehartclinic-rx
- walterspharmacy
- trianglepharmacy-westcolumbia
- auburnpharmacy-holden
- avitapharmacy-birmingham
- cobornsrx-2022
- farmaciadelpueblo-calexico
- hankinsondrug
- manitowocpharmacies
- mckinneysapothecary
- medicineshoppe-webbcity
- milfordstreetpharmacy
- pharmacy575
- prospectdrugs
- rainylakepharmacy
- rogerspharmacy-dumas
- theprescriptionshop-calhoun
- avitapharmacy-sanrafael
- corleyspharmacy
- josephpharmacy
- parkwaydrugs-leland
- theprescriptionparlour3
- readyrxpharmacy
- parkwaydrugs-frenchrd
- rxexpresspharmacy
- abcmedcare
- alumcreekatsandplant
- bullhookcommunityhealthcenterpharmacy
- davisdrugcompany
- mikesrx
- pharmacarecompounding
- shriverspharmacy-wellnessiv
- somersetmedicineshoppe-ky
- sunlifepharmacy-eloy
- tinrx-805
- westminsterfamilydrug
- acaciaapothecary-2
- allendrugandvariety
- asmhomedelivery
- avitapharmacy-kissimmee
- genscripts-admin
- harbordrug-harborbeach
- healthridgepharmacy
- northbronxpharmacy
- starlingpharmacy
- uptowndrugandgift
- yorkandcompanypharmacy
- pangolin
- centraloklahomafamilyrx-colony
- customedicapharmacy-northend
- kempsonrexalldrugs
- meadowmontpharmacy
- medcare-bennettsville
- medleypharmacy-gerald
- rxexpresspharmacyofeastnorthport
- sarasotacompoundingpharmacy
- waterburypharmacy
- westcoastrxpharmacy-thousandoaks
- chicopharmacy
- drugsamericapharmacy
- familyrx-enid
- hendersonpharmacyservices
- lajarahealthmartpharmacy
- lovelandcommunityhealth
- nockleyfamilyrx-scranton
- plainsdrug
- real-time-web-socket-server
- scottsborofamilyrx
- towerdrugspharmacy
- u-saverx-nw
- valleywiderxanddme-0419
- doverfamilyrx
- cwp-hialeah-1e42
- damienpharmacy
- garfieldpharmacy
- goudeausrx
- greenpharmacy-bronx
- medicalcenternorthshorerx
- medicap-8003
- moose-monroe
- owensborofamilypharmacy
- pharmacyplus-carrollton
- prescriptionshopmontebello
- robertjacobsonpharmacy
- rogersvillerx
- wes-test
- ahmarx-elmsford
- brownsvillefamilypharmacy
- bypassrx2
- curleyspharmacy
- cypresswellnesspharmacy
- duransrx
- heartlanddiscountrx
- knightspharmacy-berea
- laurelmedicalcenterpharmacy
- markspharmacy-brysoncity
- orbypharmacy
- pharm-a-savegranitefalls
- towneapothecary
- westmoreland-sellersburg
- portability
- allaymedsinc
- carescpharmacy
- craborchardpharmacy
- famcarepharmacy
- hollyspringsrx
- kelley-ross-ltc
- kleins-kp
- mainstrx-laurel
- medicap-cpap
- mounthorebpharmacy
- okemahpharmacy
- pathwaypharmacy
- vansdeliverypharmacy
- villagepharmacywakeforest
- vitalcareoftowson
- gooddaypharmacy-sprouts
- bellavistapharmacy
- cannonrx-sedgefield
- centercitypharmacy
- cwp-littlehavana-cb54
- greenhillpharmacy3
- hayatrx-21
- icecast-ny3
- nhrmc-employeepharm
- northfieldpharmacy
- pharmasave-monroe
- pointemedpharmacy
- ranchopueblorx
- redspringshealthcenter
- saenzmedicalpharmacy-nolana
- silvercarepharmacy
- sinksrx-gerald
- certacarepharmacy
- carerxpharmacy
- centermedicationmanagement
- drugcityrx-baltimore
- keyesdrug
- kingsrx-hayesville
- laconnerdrug-1146
- lumistrytraining
- luxemburgpharmacy
- mrhpembrokeroadrx
- professionalrx-pottstown
- ralphspharmacy
- sbhmedical
- scheurerfamilyrx-sebewaing
- schottspharmacy
- shrivershospice
- springfieldmedicenterpharmacy
- tmhspecialty
- wecarepharmacy
- whiteforddarlingtonllc
- carringtondrugs
- communitycarepharmacy
- eaglerx
- healthyurxinc-dubailst
- medicalcenterpharmacyinc
- middletownpharmacyandwellness
- pattersonhealthmart-lincoln
- pottscamprx
- vow-utils
- chapinpharmacy
- scottcitypharmacy
- citycenterdrug
- cwp-westland-cb57
- groverx-sunshine
- medi-thriftrx
- mesapharmacy
- ourhomerx-auburn
- precisioncarepharmacy
- rioricopharmacy
- rosedrugofdover
- roselawnpharmacy
- tlc-medical
- tomballhealthmartpharmacy
- villaricadrugs
- vitalcare-morrestown
- clarklowcostpharmacy
- corbychemist
- groverx
- hill-city-pharmacy2
- hometownpharmacy-campbellsville
- malakoffpharmacy
- medpointpharmacyllc
- methodist-northlake
- randrtaxservices
- rockymountmedicalpark
- sinksrx-owensville
- tricarepharmacy
- u-saveitrx-byron
- woodarddrugstore
- wooripharmacy
- medicap-gardenvalley
- bellwooddrugs
- chancydrugs-valdosta
- choicepharmacy
- goldendalepharmacy
- greenleafpharmacy
- kleins-kp4
- medicalcenterpharmacy
- mitchellscostpluspharmacy
- training
- universityrx-universityofpittsburgh
- wilsavdrugs-madisonville
- avitapharmacy-lancaster
- blacksburgpharmacy
- carispharmacy
- clermontpharmacy
- economydrug-ely
- nucara-storycity
- peoplesrx-3
- sinksrx-ltc
- talkrximage-centos7
- vicsrx1
- vitalcareinfusionservices-keller
- wesleysdev
- millstreetpharmacy
- alliedpharmacy
- as-salampharmacy
- expressrx-prescott
- greenhillpharmacy2
- hillsdrugstore
- idabelexpresspharmacy
- indydrugco
- k-cpharmacy
- locost-savannah
- mccarthyspharmacy
- morethanmedicine
- moweaquapharmacy
- petsandpeoplepharmacy
- riversidepharmacy
- u-saveitrx-pinemountain
- pittmanspharmacyinc
- allcarepharmacy
- barrettpharmacy
- boonevillepharmacy
- caduceuspharmacy
- crescentdrugandapothecary
- forwardpharmacy-mcfarland
- handsrxatchapelhill
- heartland-auburn
- leggettdrugco
- portervillepharmacy2
- thedrugstore-lincolnton
- silveradopharmacy
- akersrx
- baysidepharmacy
- bryars-warrendrugco
- centraldrugs-lahabra
- decaturvillagepharmacy
- jonesmccallhealthmartrx
- kiowacountypharmacy
- magnoliapharmacy
- millerspharmacy-wyckoff
- mycareexpresspharmacy
- nationalrx
- paylessdrugs-birmingham
- pelhamcommunityrx-pelmeds
- realodrugs25
- thepharmacia-woodholme
- tomlinsonspharmacy
- drugco-ahoskie
- kettlefallspharmacy
- riesbeckspharmacy-bridgeport
- rileysmedicalequipment
- u-saveitrx-leecounty
- windroserxllc
- drugroom
- bmwrx
- centraloklahomafamilyrx-arlington
- cortezdrugs
- friendlycitypharmacy
- gardensdrugs-westpalmbeach
- longbelladrug
- medicinemanpharmacy-jfk
- mtzcompoundingrx
- ricks-carolinarx
- shorelinepharmacy
- sullivanpharmacy
- thepharmacyathuntregional
- adamsdrugs-tallassee
- kingsrx-murphy
- avitapharmacy-satx-1075
- baystreetpharmacy
- homerdrugs
- parvinspharmacy
- realodrugs-chm
- restorativecompoundingpharmacy
- scottspharmacy-macon
- vitalcareofpalmdale
- hilltoppharmacy-clarksville
- advancedcareofomro
- bordelonssupersavepharmacy
- kratzershometownrx-mountorab
- madisonapothecary
- mainline-rx-hastings
- mm-medcare
- advancecarepharmacy
- bettercarerxpharmacy
- lexingtonchemist
- medicap-8082
- mlkpharmacy
- nucara-nevada
- paul-test
- phippspharmacy-hunningdon
- premierzephyrhillspharmacy
- primarycarepharmacyservices-westmifflin
- ramtownpharmacy
- reedspharmacy1-berkeleysprings
- tiffanynaturalpharmacy
- tomsriversidepharmacy
- westconcordpharmacy
- goldendrug-richfield
- zayanpharmacy
- autobuild
- avalonpharmacy
- avitapharmacy-portland
- carerxpharm
- cornerstone-rosecity
- familyhealthpharmacy
- jeromedrugs
- laduepharmacy
- lorexdrugs
- maddoxdrugs
- pharmacyofdunlap
- pharmacysolutions-arlington
- piedmontdrug
- realodrugs6
- sunrx
- wamegodrugstore
- everwellspecialtypharmacy
- avitapharmacy-washingtondc
- foothillsrx
- keeverrx
- latiendapharmacy
- nordicpharmacy
- talkrximage
- candlerrx
- einsteinapothecary
- freelandbrownpharmacy-1
- gil-cofaithpharmacy
- harperpharmacy
- medicineshoppe-sandiego
- newenglandpharmacyandwellness
- plazapharmacy
- prestonspharmacy
- villagerx-gardendale
- nuripharmacy
- adamspharmacy
- avitapharmacy-greenville
- brownpharmacy
- bryancollegestationchc
- communityhealthcare-tacoma
- dalydrug
- hometown-mountvernon
- hopehealthpharmacy-pineneedles
- niagaraapothecary
- openvpn-test
- pharmacyplus-greenfield
- pinebrookrx-1
- solusrx
- toledoclinic
- oceanparkrx
- bandysrx-irvington
- columbiaheightspharmacy
- hancockpharmacy-v
- heartland-mtnhome
- kindredcarepharmacy
- lukesfamilypharmacy
- martindrugdba-thriverx
- premiercarepharmacy
- semodrug
- sutterpharmacy
- thepharmacyatpjbean
- trinitypharmacy
- turnersdrug
- wichitacountypharmacy
- hugoexpresspharmacy
- halifaxdrug
- carefirstpharmacy
- cambridgehealthalliance-cabot
- gerouldsrx-3
- homewoodpharmacy
- hospitaldiscountrx-central
- josephrx-newyork
- lilyspharmacy
- medcentapharmacy
- pinebrookrx-4
- qdpharmacy
- rxclinic-harrisblvd
- vhs-atlanticshores
- giantdiscountdrugs
- medicalcenterpharmacy-gastonia
- accuserv
- alivationpharmacy
- donganhillspharmacy
- madisonaverx
- mainst-pharmacy
- orangecutratedrug
- petersburgrexalldruginc
- rosecitypharmacy
- rowlandoldmainpharmacy
- spalittospharmacy
- qvspharmacy-3
- carefreecompoundingandwellness
- familycarerx-tysons
- hill-city-pharmacy3
- hollisdrugsandsurgical
- johnspharmacy-charleston
- justicepharmacy
- means-laufsuperdrug
- monarchpharmacy
- oldpasadenarx
- seymouradvaluepharmacy
- tysondrugs
- smithscountryclubdrugstore
- avance-care-pharmacy
- bullochsdrugstore
- callsign-nyc-1
- chowchillapharmacy
- crchcpharmacy
- cwp-homestead-1e41
- dreierpharmacy
- harrisburgclinicpharmacy
- mayerspharmacy
- mckenneypharmacy
- newronsondruginc
- newwalkerspharmacy
- chrispharmacyofgonzales
- clarksdalepharmacy
- silverrodpharmacy
- threebearspharmacy-kenai
- wombledrug
- clevelandlowcostpharmacy
- cornerstone-rogers
- dannyspharmacyii
- folsepharmacy
- garyandleospharmacy
- hudsondrugshop
- kingsrx-parkslope
- owlbusinessoffice
- physicianschoiceinfusion
- prescriptioncentresurgicals
- quinnfamilypharmacy
- sandjpharmacy-sanger
- southwoodpharmacy
- stovallsprescriptionshop
- theburghpharmacy
- u-saverx-grandisland
- unionltcpharmacy
- acediahealth
- basaltclinicpharmacy
- cobornsrx-2038
- cwp-coralgate-1b39
- guyspharmacy-crystalsprings
- ivyspecialtycompounding
- meyerrx
- southernrx
- summersrx-butler
- wellnessfamilypharmacy
- medchoicepharmacy-denison
- bluegrassdrug-carrollton
- cornerstone-markham
- guffeysdrugstore
- homerxhealthcare
- longevityscripts-fortmyers
- lopezislandpharmacy
- madisonparkpharmacy
- u-save-pharmacy-south
- vicklundpharmacy
- watertowndrugs
- stotlardrugcompany
- tuscaloosadrugcapstone
- redcarpetpharmacy
- oldbridgedrugsandsurgicals
- bannerdrug-downtownstatesville
- 501pharmacy
- asheville-compounding
- bestchoicepharmacy
- expressrx-joplin
- familycarediscount
- firstcarepharmacy-hays
- hinashomecarepharmacy
- lakehillspharmacy
- medellapharmacy
- medicaltowerpharmacy
- okolonapharmacy
- parkvillepharmacy
- teamspharmacycorp-medicinetogo
- threenotchpharmacy
- uniontownmedicalpharmacy
- valleydrug-everson
- bootheeldrugs
- cannonrx-mooresville
- cullfamilypharmacy
- cwp-kendall-1d05
- erik-ivr
- gwinnettdrugs
- jimsu-savepharmacy
- johnspharmacy-capegirardeau
- klamathtribalhealth
- medicinecenterrx-louisville
- medicineshoppe-baltimore
- mendpharmacy
- northsideapothecary
- palacepharmacy
- spagespharmacy
- thepharmacyatcmc
- tulalipclinicalpharmacy
- tulaneuniversitycampushealth
- barrachinapharmacy
- bypassrx5
- cascadesinsurance
- emmausdrugstore
- evanspharmacy-stockton
- lifelinebaltimorepharmacy
- peachtreehealthpharmacy
- pembertonpharmacy-salisbury
- quinlanspharmacy
- raymondrx
- westmilfordpharmacy
- my-beta
- kirbywhittenpharmacy
- avitapharmacy-austin
- bellin-health-meds-wrightstown
- cornerstone-littlerock
- cwp-linton-bb05
- cwp-olathe-1e98
- gallatinprescriptionshop
- greenportdrugsllc
- hometown-hopewell
- keydrugs-poplarbluff
- lumbertonhealthcenter
- minutesrxpharmacy
- shriverspharmacy-logan
- williamsburgdrugco
- harrisdrugstore
- longrx
- welltopiarx
- arnzensglenwoodpharmacy
- cwp-e-hialeah-cb55
- dakotadrugofstanley
- kubatrx-fremont
- malvernfamilypharmacy
- nucararx-coralville
- peninsulacompounding
- dightonpharmacy
- pooler-pharmacy
- professional-rx-rosedale
- vowlab
- vytosrx-kennedy
- princetondrug-ky
- chancydrugs-northvaldosta
- riverwoodmcgregorclinicrx
- professionalpharmacy-dalton
- alafiyapharmacy
- apothicareatlakewoodranch
- araratpharmacy
- avitapharmacy-jackson
- danielspharmacy-denmark
- franklinpharmacy-wichitafalls
- lakewylie-pharmacy
- medfirstpharmacy
- stonegatepharmacy-broadway
- medicinemanpharmacy-northbend
- finleypharmacy
- ashvilleapothecary
- barkerspharmacy
- barrysmontvillepharmacy
- berneyspharmacy
- brame-temp
- crystalpharmacy
- familycarerx-mc
- goodlarkpharmacy-fairview
- lowellcommunityhealthcenterrx
- medicalpark-dublin
- medsourcescripts
- oldtownclinicpharmacy
- oneals-belhaven
- peoplesrx-1
- southernvillagerx
- stonespharmacyinc
- vowuniversity4
- wannamakerdrug-chesterfield
- cloquetmedicineshopperx-skyline
- andrewsapothecary
- carrollpharmacy
- cwp-sw8thstreet-f508
- fresnomedicineshoppe-marksave
- kpharmacy
- medicinemanpharmacy-omaha
- neighborhoodfamilypractice-ridge
- peninsulapharmacy
- peoplespharmacyandfoodmart
- petersonpharmacy
- reedspharmacy2-hedgesville
- rumsonpharmacy
- simplywellspecialtyrx
- valleypharmacy-sugarloaf
- whisperingpines
- calmontpharmacy
- careswaypharmacy
- clarkshubcityrx
- healthdepot-1
- kingmandrugstore
- mowrymedicaltemp
- northfloridarxofbranford
- princetondrug
- thebeavertonpharmacy
- baileypharmacy
- cashwiserx-3011
- evansdrugs-nevada
- fairmontdrugcompany
- healthcenterrx-winfield
- moosepharmacy-kannapolis
- preferred-pharmacy
- savannahfamilyrx
- trummdrug-clinicpharmacy
- wyattsrx
- abhpharmacyandmedical
- baychemists
- bellsfamilydrug
- capstonepharmacy
- gunbarrelcitypharmacy
- kollhoffpharmacy
- medicap-scottcity
- minthillpharmacy
- multnomah-westside
- parkwaydrugs-albanyst
- puppetcompiler1
- southsidedrugcompany
- stanleyspharmacy
- stgeorgefamilypharmacy
- thomas-drug
- tylerbrothers
- tritownpharmacy
- login
- avitapharmacy-lakecharles
- bypassrx
- dixie-clarksville
- goodhopepharmacy
- parkpharmacy
- payless-drugs-fairfield
- sedgleyplazapharmacy
- stlukeslowcostpharmacy
- thompsonspharmacy
- u-saverx-kearney
- medicalartsrx-henderson
- peachtreerx
- teleport
- vitalcareinfusionservices-boise
- brownsdrugstore
- centralavenuepharmacy
- connectcare
- farmersuptownpharmacy
- goldsmithmedicenterrx
- littleneckdrugstore
- medicalcenter-hickory
- millersdrugstore
- pattersonfamilyrx
- unionmedicalpharmacy
- walhallapharmacy
- walnutpharmacy
- advancedvitalcare
- allensmedicalpharmacy
- aracomadrug-chapmanville
- downtownrx-ny
- gibsonpharmacy
- johnsoncitymedicineshoppe
- kellys-familyrx
- marathonhealthcenter
- nockleyfamilyrx-hanover
- purdycostlesspharmacy
- rosauerspharmacy-09
- valuemartrx
- vrxsolutions
- wellcenterpharmacy
- realodrugs13
- villagewellness-ladylake
- cambridgehealthalliance-revere
- majoriadrugs5
- peoplescompoundingcenter
- sincererxhometownpharmacy
- upstreampharmacy
- cumberlandpharmacy
- marshallmedicpharmacy
- pacificapharmacy
- unionfamilyrx
- vicsrx2
- villagerx-baldwin
- nordahlpharmacy
- auburnpharmacy-lindsborg
- avitapharmacy-nashville
- cwp-miramar-f461
- jwchpmqlynwoodrx
- padekhealthcarepharmacy
- petaldrugco
- southendpharmacy-houston
- staywellpharmacy
- candddrugstore
- medicinecenterrx-newphiladelphia
- rtws.dev
- blacktailpharmacy
- bookspharmacy
- digital-bubbasmedshop
- hilltoppharmacy
- hurricanefamilyrx-wv
- kellyspharmacy1
- linsonpharmacy
- medicalcenter-piedmont
- nucara-fairfield
- siglerrx1
- willowpharmacy
- bestvaluewaddyrx
- clevelandurgentcare
- flatironsfamilyrx
- hilandpharmacy
- killdeerpharmacy
- leerdfamily
- northbeachespharmacy
- premierrxandwellness
- sheehanspharmacy
- stanleyrx
- test-ivr
- yazoodrugcompany
- buyritedrugs-havana
- communityfirstrx-dayton
- craigsdrugstore
- evartpharmacy
- grovelandpharmacy-ca
- guyspharmacy-tylertown
- jordanvalleycommunityhealth-grand
- oakridgecare
- riesbeckspharmacy-southzanesville
- rosedrug-russellville
- tabbfamilypharmacy
- tablerockpharmacy
- aberdeenpharmacy
- biglakepharmacy
- familycarerxpharmacy-closeddoor
- foodgiantdiscountrx
- lakelandpharmacy-forsyth
- medicineshoppe-2103
- nicholsapothecary
- prosperpharmacy
- univofkansas-cambridgenorthretailrx
- easthickmanpharmacy
- ivywildpharmacy
- mainstrx
- medicinemanatholpharmacy
- pelhampharmacy
- mcdowellspharmacyofgatescounty
- avitapharmacy-bellaire
- avitapharmacy-neworleans-1037
- wheelercountydrugcompany
- purecarepharmacy
- aubreypharmacy
- avitapharmacy-ftmyers
- paylessdrugs-springville
- richlandvillagedrug
- silverstatedrug
- stpaulcornerdrug
- universalartscompoundingpharmacy
- univofkansas-uat
- valleypharmacy
- westmainpharmacy
- springspharmacy
- centralpharmacy-macdonald
- bachpharmacynorth
- bergennewbridgemedicalcenter
- bridgeportfamilypharmacy
- costlessrx
- hersheypharmacy
- levitest
- medicap-8023
- portolavillagepharmacy
- prescriptionreadyrx
- richfieldcommunitypharmacy
- route66pharmacy
- trspharmacy
- uptownuniteddrug
- villagepharmacyoffruitport
- royaltypharmacy
- bellin-health-pharmacy-seymour
- clementsdiscountdrugs
- collegehilldrug
- mcleod-choice-pharmacy
- medicineshoppe-1675
- mikesrx-pasadena
- northwestprescriptionsandmedsupply
- pratersrx-webbcity
- robertjacobsonsurgicalpharmacy
- rockhillpharmacy
- thepharmacyplace
- stjosephpharmacy-phillipsburg
- auburnpharmacy-osawatomie
- brewermedicalcenterpharmacy
- brownsvillepharmacy
- coatsrx
- cwp-gastonia-1e95
- horizonpharmacy
- mcglynnpharmacy
- midlandpharmacy
- mtwelcomepharmacy
- omnifamilyhealth-panama
- rxexpresspharmacyofpascagoula
- sav-morpharmacy-corporate
- somersetparkrx
- thepharmacyinc-bennington
- unionhealthservice
- diamondpharmacy
- ivyleapharmacy
- kapiolanimedicalcenteroutpatientrx
- mastersspecialtyrx
- new-middletown-rx
- redcrosspharmacy
- seitzdrugcompanyinc
- skidmorepharmacy
- valleywidepharmacy
- stocktonpharmacy
- tuscaloosadrug5points
- broadwayapothecary
- capepharmacy
- chancydrugs-adel
- durandtelepharmacy
- expresscarepharmacy
- kiowahealthmartrx
- mainstpharmacy
- oneiropharmacy
- professional-rx-williamsburg
- sheefapharmacyandwellness
- shriverspharmacy-loudonville
- wecarerx
- westreadingdrugstore
- acresrx
- chaffeedrugstore
- dylanscottagebakery
- familyhealthcenter-stgeorge
- frontrangepharmacy
- gandmpharmacy
- horseshoe-temp
- kratzershometownrx-lebanon
- managed-print
- mizellesdiscountdrug
- neighborhoodfamilypracticepharmacy
- pinetopspharmacy
- powerspharmacy
- rapoportpharmacy
- realodrugs10
- seriospharmacy
- villagepharmacy-gilbert
- rxexpresspharmacyofcommack
- lennysrichfieldfamilyrx
- yorkepharmacy
- bolivardrug
- greenpharmacy
- hayatrx-17
- healthyurxinc-williamst
- hogans-pharmacy
- hugosfamilypharmacy-7
- ihcpharmacy
- jamespharmacy
- u-saveitrx-commerce
- u-saveitrx-downtown
- u-savepavilionpharmacy
- api-lumistry
- adamsdrugs-chantilly
- avitapharmacy-charleston-1056
- centralpharmacy-nj
- cornerdrugs-chatsworth
- fannininfusionpharmacy
- funkpharmacy
- healthcarepartners-marion
- lakemurraydrug-irmo
- medicineshoppe-fishkill
- medimaxpharmacy
- pharmacyplus
- sayreprofessionalpharmacy
- supervaluepharmacy
- vinniespharmacy
- api-gw
- laudenpharmacy
- mccoytygartdrugstore
- zach-test
- bergenlinedrugs
- duprepharmacy
- empirespecialtyrx
- hamburgpharmacy
- hayatrx-5
- lantzsrx
- laquintapharmacy
- madisonmedicalpharmacy
- medicineshoppe-danielsville
- paxpharmacy-ii
- realodrugs5
- wolcottpharmacy
- yorkwellnesspharmacy
- avitapharmacy-orlando
- bennettfamilypharmacy
- chrispharmacy-maurepas
- clovercarepharmacy
- colonianaturalcare
- cwp-newbraunfels-1b50
- essentialrx
- galtpharmacy
- hallerspharmacy
- jacksmarketpharmacy
- maderamedicalpharmacy
- medicap-8256
- morton8thstpharmacy
- clintondrug-nc
- frickspharmacy
- registercliffpharmacy
- crescentcommunityhealth
- avitapharmacy-winnetka
- cfh-biloxi
- hospital-washington
- johnspharmacy-puxico
- rockcreekrx
- villagehealth
- skylinepharmacy-fortworth
- vitalcare-jackson
- citycarerx
- cwp-midtown-1e97
- duvallfamilydrugs
- everettspharmacy
- hrxpharmacy
- jonesboroughmedicineshoppe
- kernersvillepharmacy
- macpharmacy-4
- medicenterpharmacy-carterville
- medz2home
- newportcenterpharmacy
- realodiscountdrug-trenton
- summitrxpharmacy
- trummdrug-parkersprairie
- aandapharmacy-leland
- avitapharmacy-lamont
- bestvaluecustommeds
- citypharmacy-springdale
- colfaxpharmacy
- conwaysdanvillepharmacy
- geneseopharmacy
- gooddayrx-dougs
- heb-demo
- hokesbluffdrugshoppe
- northchesterpharmacy
- phippspharmacy-jackson
- adelhealthmart
- atkinspharmacyservices
- avitapharmacy-elysian
- brickcitydrugs
- citydrug-clayton
- leesilsbycompoundingpharmacy
- medicineshoppe-baldwin
- medicineshoppe-columbiapa
- rosauerspharmacy-02
- rxculpeper
- veniceapothecary
- vitalitydrugandsurgical
- goodlifepharm
- superemacarepharmacy
- clinicdrug
- shriverspharmacy-dresden
- 72ndstpharmacy
- calabasaspharmacy
- clearwatercanyonrx
- lumbertondrug-west
- nehalembayhealthcenter
- sandcastlepharmacy
- vaughnpharmacy
- westatlanticpharmacy
- wholescriptspharm
- t-dpharmacyinc
- bayridgerx
- brandonmedicineshoppepharmacy
- cwp-quailroost-ca64
- danspharmacy
- getwellpharmacy
- gooddayrx-johnstown
- groveparkpharmacy
- kch-outpatient-pharmacy
- medicalpharmacysouth
- oldforgepharmacy
- oxfordpharmacy
- palmettopharmacymedicineshoppe
- rivercitypharmacy
- robalopharmacy
- southgatedrug
- starcarepharmacy-arizona
- stmaryspharmacy
- vcarepharmacy-newhampshire
- webberpharmacy
- woodlanepharmacy
- pinonfamilyrx
- truepharmacy-easley
- brickcitycompounding
- clinicrx-devilslake
- greenparkcompoundingrx
- guyspharmacy-summit
- hancockpharmacy-vi
- hayatrx-19
- healthdepot-2
- mountaincarepharmacy
- parklandrx-ironton
- puppet-tlsopus-test
- whitestonepharmacy
- theprescriptionshop
- choicespecialtyrx-woodlands
- eltejonpharmacy1
- granitepharmacy-libby
- medicineshoppe-lancaster
- morganrx-williston
- osteenspharmacy
- puppetlb
- smackoverpharmacy
- stuartdraftfamilypharmacy
- swisherandlohse
- vitalcare-canton
- wilsonfamilypharmacy
- woodinvillepharmacyinc
- ritterexpresspharmacy
- hardiesdrugstore
- eaglerockpharmacy
- basinpharmacy
- daytondrugandwellness
- delmarvapharmacy-princessanne
- gracecommunitypharmacy
- grandaverx
- medicinemanprairiepharmacy
- mountairydrug
- precisionpharma
- robinsonspharmacy
- sheligadrug
- siglerrx2
- tallulahpharmacy
- battsdrugcompany
- hartsvilledrug
- hartzellspharmacy
- lakelandrx-bransonwest
- medicinemart-gaffney
- owltri-statepharmacy
- parishpharmacy
- southrivercompoundingrx-westend
- willowbrookpharmacy
- centerdrugsofdaleville
- longbeachrx
- byrd-watsonrx
- castellonpharmacy
- citydrugs-grovehill
- cordespharmacy
- cwp-ipsec
- easyrx-holyredeemer
- hawthorne-taylor
- hometown-marshall
- jimspharmacyatthelake
- mednorthhealthcenterrx
- pratersrx-seneca
- theclinicpharmacyinseminole
- thompsonslakecountrydrug
- vitalpharmacy
- willowspharmacy
- expressrx-cantrell
- obrienanddobbinspharmacy
- surecarepharmacy
- u-saverx-north-platte
- cwp-stateave-1e96
- libertymedicenterpharmacy
- longleyspharmacy
- richiesspecialtypharmacy
- rochellepharmacy
- simonsdiscountpharmacy
- thepharmacyatdesoto
- ben-test
- bestvaluerenshawdrug
- boazdiscountdrugs
- cubdrug
- donsrx-porttownsend
- doughertyspharmacy-mcalester
- familydrugmart-slidellwest
- giantgeniepharmacy
- knoxprofessionalpharmacy
- martinspharmacy-pulaski
- newpharmacy-29palms
- pharmasavemonroe
- popkesspharmacy
- stoutstreethealth
- washoetribalhealthclinic
- prosperitydrug
- ahfpharmacy
- cokerhamptondrugcompany
- funderburkspharmacy
- lakesidepharmacy-havasu
- longliferx
- drugworld
- frenchtownpharmacy
- hill-city-pharmacy
- thriftywaypharmacyoflakecharles
- avitapharmacy
- avitapharmacy-nashvillemeharry
- callsign-sfo-1
- communitycarerx-malvern
- hancockpharmacy-vii
- leescitydrug
- lincolnprimarycarerx
- mainline-rx-murrysville
- mclaughlinsdrugstore
- merryfieldpharmacy
- qualitycarerx
- staniferdrugs
- stoneplazapharmacy
- summersrx-clintonclinic
- boydspharmacy-mansfield
- camelbackcompoundingpharmacy
- freedompharmacy-hattiesburg
- goodlarkpharmacy-dickson
- hickoryhillrx
- katzpharmacy
- beggspharmacy
- bestyethealthmartpharmacy
- childrenspharmacyservicesnew
- farmaciaviva
- hayatrx-16
- kleins-kchc
- martinsvillepharmacy
- medonepharmacy-thurmont
- middleportfamilyhealth
- prestondrug
- walterboropharmacy
- 986pharmacy-lakearrowhead
- austinspharmacyinc
- dailydosepharmacy
- edsmedicenter
- expressdiscountpharmacy
- goldenvalleyrx
- medicineshoppe-newportrichey
- phippspharmacy-mckenzie
- smyrnamedicineshoppe
- gussdrug
- citydrug-coweta
- douglasmainpharmacy
- ihs-jeffersonville
- medicap-8213
- meridianhealthcare
- pharmacyarts
- quickstop
- sozowellnesscenter
- waynesboro-apothecary
- wurlitzerfamilypharmacy
- lawsonspharmacy
- acedrugs
- apotheworx
- capitalregionalrx
- carmichaeldrugs-vitalcare
- cashwiserx-3041
- citihealthrx
- cornerstoneapothecary-vanhorne
- dimaspharmacy
- donellspharmacy
- ferndalepharmacy
- healthsmart-newton
- marshlandpharmacy
- medi-thriftlafayette
- saterpharmacy
- scriptcopharmacy
- semmespharmacy
- test-ae
- westburyrx
- yostpharmacy
- hometownpharmacy-richmond
- purepharmacy
- accuserv-ltc
- bigcdiscountdrugs
- buyritedrugs-portstjoe
- calebshometownrx
- communitycarerx
- first-carerx
- klingensmithsdrugstores-kittanning
- kremerpharmacy
- thornedrug
- vitalcareofmadison
- woodbridgepharmacy
- vitalcare-springfield
- brinkleyfamilypharmacy
- amberwellpharmacy-atchinson
- briargroverx
- bubbasmedshop
- citymedspharmacy
- davycrockettrx
- ipsectest1
- lincolnpharmacy-albany
- lowrysprescriptions
- marionfamilyrx
- mcleskey-todd
- medicap-8230
- mmcpharmacy
- northlakepharmacy
- potterdrug-athens
- preferredrx-loudon
- realodrugs24
- roundrockisdpharmacy
- sevenlakes
- u-saveitrx-griffin
- vowuniversity1
- westendpharmacy
- leonardpharmacy
- wolkardrug
- add-drug-ltc
- heartland-bentonville
- hieberspharmacy
- magicmartpharmacy
- richmond-hill
- matawanpharmacy
- applediscountdrugs-2
- elkhornpharmacy
- enexiaspecialtyrx-portrichmond
- thechosenpharmacy
- centerdrugs-geneva
- yellowstonepharmacy
- u-saverx-mccook
- auburnpharmacy-garnett
- bestvalueroycesrx
- centralpharmacy-weslaco
- expressrxpharmacyandmedsupplies
- omropharmacy
- ralphsfamilypharmacy
- u-savemilfordpharmacy
- willacoocheepharmacy
- adamsdrugs-copperfield
- api
- commwellhealthdiscountpharmacy
- cornerdrug-coloradocity
- culinarypharmacyi
- cwp-pahrump-1e43
- kexrxpharmacy-horton
- kingslandpharmacy
- lakeviewpharmacy-racine
- lovelldrug
- medicalartschemists
- onamiadrug
- ripleydrugs
- wrensdrug
- northunionmedicineshoppe
- cascaderx
- bigforkdrug
- bsmcpharmacy
- bypassrx3
- carefirstspecialtypharmacyllc
- crittendens-drug
- digital-whartonpharmacy
- eastmandrugs
- hancockpharmacy-1
- hiawasseehometownpharmacy
- pacificmedicineshoppe
- professionalcenterpharmacy
- valleypharmacy-seymour
- gibbspharmacy
- betterlifepharmacy-grove
- capecodhealthcare-capecodhospital
- colemanpharmacy
- expressrx-carthage
- haydenpharmacy
- hometown-clinic
- macpharmacy
- orangetreerx
- popularpharmacy
- summitexpresspharmacy
- vcarepharmacy-ct
- wrightpharmacy-stuart
- bigsandyrx
- cobornsrx-2008
- cwp-45thstreet-fc56
- healthcarepartners-sc
- lawrencedrug2
- lynnspharmacy-hewitt
- medicalcentrepharmacy
- medicineshoppe-rapidcity
- nucara-lisbon
- peninsulapharmacyplus
- pepperellfamilypharmacy
- truepharmacy
- villageshirespharmacy
- vowtest
- lagunawoodspharmacy
- linkpharmacy-lakeland
- pineridgepharmacy
- andersondrug
- avitapharmacy-chicago
- bestvaluewestrx
- bondcountypharmacy
- bunndrug
- cwp-w-hillsborough
- fulmerusavepharmacy
- kaweahhealthpharmacy
- keydrugs-dexter
- lemonaidcommunitypharmacy
- margolispharmacy
- ohdepharmacy
- oldephillypharmacy
- avitapharmacy-nhollywood
- farmaciacaridad9
- fredericapharmacy
- maconcitydrugstore
- macpharmacy-3
- medicarx-bardstown
- michaelsprescriptioncorner-hobbs
- porterfamilyrx
- prevodrug
- smithgallspharmacy
- westmoreland-jeffersonville
- crestrxpharmacy
- applerx
- carepharmacy
- lakecountryrx-eatonton
- lowesdrugs
- medicpharmacy
- mypharmacy-piscataway
- pencolcompoundingpharmacy
- stroudcompoundingdrugstore
- u-saveitrx-adel
- valumed-ftgibsonpharmacy
- 4-corner-rx
- birdsboropharmacy
- gideonpharmacy
- kawaiolapharmacy
- battens-prescription
- cayucospharmacy
- chocowinityrx
- gonzalesrxpharmacy
- jnrpharmacy
- larkincommunityhospital-palmsprings
- medicinemannorthpharmacy
- medsave-nicholasville
- oaklandrx
- savondrugshealthmartpharmacy
- shriverspharmacy-zv2
- southernstarrx-002
- sugarspoonhometownpharmacy
- val-u-medhealthmart
- ashevillemountainrx
- avitapharmacy-austin1
- bonapartepharmacy
- dilloncommunitypharmacy
- dupontcirclerx
- goodrichpharmacy-andover
- hillcrestpharmacync
- palmharborrx
- w5pharmacy
- alvaradopharmacysd
- boonememorialpharmacy
- cobornsrx-2031
- deltapharmacy-riovista
- khangpharmacyllc
- hometown-lexington
- invictusventures-hq
- frdsav-morpharmacy
- avitapharmacy-salisbury
- blythewoodpharmacy
- expressrx-vardaman
- granitedrugcenter
- helenadrugs
- kubatrx-fremonthme
- mypharmacy-greensboro
- ncapharmacy
- ridgewaypharmacy
- wesleysdev-fluent-two
- berkeleyhome
- carefirstspecialtypharmacy
- chambersapothecary
- dennisrx
- grantspasspharmacy
- realodrugs2
- sanandreaspharmacy
- vialidodrugs
- riesbeckspharmacy-shadyside
- barnesarcatafamilydrug
- fairfieldcommunityhealthcenter
- hoganspharmacy-ga
- lawtonheritagepharmacy
- mainline-rx-nanty-glo
- reedspharmacy
- smartmedprescriptioncenter
- cwp-pineisle-f513
- familycarerx-university
- familyrx-vernon
- herrindrug
- hometown-campbellsville
- liveoakpharmacy-plano
- medicap-8281
- pharmoryrx
- realodrugs-fouroaks
- reidhospitalpharmacy
- sav-ritepharmacysouth
- smalltownpharmacy
- talkrximage-vultr
- vanguardpharmacy
- westatlanticdiscountpharmacy
- westgatepharmacy
- mikesmedicalpharmacy
- bellin-health-pharmacy-memorial
- clarindaregionalhealth-communitypharmacy
- gooddayrx-greeley
- hamptonpharmacy
- hocks-piqua
- kellyspharmacyandcomp
- maddenspharmacy
- medicineshoppe-stcharles
- riverwoodgarrisonclinic
- rochestercarerx
- rolsethdrug
- saintmariapharmacy
- somcpharmacy-main
- usavepharmacy-lexington
- villagrovepharmacy
- abeldtsgaslightpharmacy
- advancedrx060
- bestvaluedansrx
- dinubapharmacy
- familyrx-enid-3
- gooddayrx-springcreek
- hayatrx-22
- hometown-frankforteast
- medicineshoppe-phelan
- medworkspharmacy
- primespecialtypharmacy
- springbranchpharmacy
- victorsmedicenter
- wrightpharmacy
- twainhartepharmacy
- cashiersvalleyrx
- creswellhealthmartrx
- healthsmart-startown
- jerseyshorepharmacy-barnegat
- meccarx
- medinamedicineshoppe
- norlandavenuepharmacy
- realo-extendedcare
- selmapharmacy
- tallentdrugstore
- toddsrx-camden
- whiteoakpharmacy-nutley
- heliosrx
- grizzlypharmacy
- blackburncenterpharmacy
- downtowndrug-co
- empireprofessionalrx-glenburnie
- hometown-frankfortwest
- kreislercountrypharmacy
- niemannharvestmarket
- redappleinteractivepharmacy
- sav-morpharmacy-neoga
- scripx
- shriverspharmacy-mcarthur
- somcpharmacy-south
- townshipprofessionalpharmacy
- clearlakeprofessionalrx
- eastsidepharmacy
- familyprescriptioncounter
- integrityrx-somerville
- millsfamilypharmacy
- nucara-ackley
- parisapothecary
- reinbeckrx
- savcopharmacy
- summersrx-clinton
- themedicineshoppe-ridgway
- threebearspharmacy-butte
- tinrx-808
- candlerprescriptioncenter
- cwp-delray-f506
- firstchoiceprimarycare
- parklanddrugs-cavecity
- pillboxpharmacy-waco
- saenzmedicalpharmacy-lonestarplaza
- spartapharmacy
- villagespharmacy
- vowuniversity8
- you1stpharmacy
- moosepharmacy-mtholly
- wagnerpharmacy
- apothecarepharmacy-radcliff
- evansdrugs-bolivar
- familyrx-jonesboro
- houserdrugcompany
- papasfarmacia
- reedspharmacy5
- smithsstationpharmacy
- thompsondrugsouth
- valuerx-burgaw
- goldenislesrx
- bemisdrug
- goodsonpharmacy
- healthsmart-conover
- highland-albuquerque
- hopepharmacy
- kamailio-nyc3
- klingensmithsdrugstores-westkittanning
- lombardpharmacy
- medicap-catawba
- saenzmedicalpharmacy-north
- scheurerfamilyrx-pigeon
- shriverspharmacy-athens
- thibodauxregionalpharmacy
- u-saverx-bainbridge
- clinicpharmacy
- cwp-orchardpark-1d21
- omniprescription
- owegopharmacy
- alisalltcpharmacy
- avitapharmacy-wcovina
- hayatrx-8
- johnspharmacy-corporate
- lauraspharmacy
- nucara-lenox
- pharmacyplus-roodhouse
- puppetdb
- valleywiderxanddme
- vitalcare-greenville
- lookoutpharmacy
- bentonpharmacy
- applecapstone
- familycarehealthcenters
- aronspharmacy
- cwp-n-miamibeach-df80
- heartland-cabot
- meadowcrest-gretna
- orangepharmacy
- palmcare-sandiego
- sectionpharmacyinc
- trinityvalleypharmacyllcretail
- wellnesspharmacy
- accesshealthpharmacy-fayetteville
- betterlifepharmacy-garwood
- innovarx-ii
- josefs-mainst
- kleins-front-street
- littledrugs
- northlakemedical
- somcpharmacy-ironton
- southernstarrx-006
- tremontoncommunitypharmacy
- velvadrug
- vincentsdrugstore
- choicepharmacy-florida
- gabepharmacy
- guyanvalley
- heartofflorida-belleview
- henryrobertsexpresspharmacy
- inlandpharmacy
- medicinecenterrx-minerva
- montevistapharmacy
- multnomah-northportland
- nourpharmacy
- badriverclinicpharmacy
- cobornsrx-2046
- cornerpharmacy-greenfield
- gordonfamilyrx
- vitalcareofmelbourne
- medquickpharmacy
- harrisburgmedicineshoppe
- hillcrestpharmacy
- kingpharmacy
- roysecityrx
- soundspecialtypharmacy
- westportpharmacyllc
- a-1pharmacymetairie
- avitapharmacy-1079-montgomery
- bassrutledgedrugcompany
- cityrexalldrugs
- healthonsouthrx
- lumistry.dev
- medicalhomepharmacy-southbroad
- medicalpharmacy-uwharre
- yatespharmacy
- andrewspackagingpharmacy
- beavertonpharmacy
- centraliapharmacy
- chemistonbay
- crmcoutpatientpharmacy
- cwp-hillsboro-ac53
- danswellnessrx
- fbthomasdrugstore
- fiverivers-familyhealthcenter
- hironsdrug2
- majoriadrugs6
- martinspharmacy203
- medicineshoppe-sanbenito
- midmichigancommunityhealth
- rockfishrx
- sanysidropharmacy
- themedicinecabinet
- towerpharmacy
- u-saveitrx-franklin
- muskegonfamilycarepharmacy
- olympiacompoundingpharmacy
- medicap-8269
- adamsdrugs-prattville
- collinsvillefamilypharmacy
- commonwealthrx
- innovapharmacyofardenarcade
- westcoastrxpharmacysantabarbara
- winchesterpharmacy
- mtwelcomepharmacyprincesses
- westownpharmacy
- accesshealthpharmacy-glendaniel
- clarksfamilypharmacy
- doradopharmacy
- grueneroadpharmacy
- js-wilsonville
- marionpharmacy-crisfield
- medicineshoppe-duquoin
- memorialregionaloutpatientrx
- parkprofessionalpharmacy
- reeffamilypharmacy
- sessermedicenterrx
- wiregrasscommunitypharmacy-ashford
- hubbarddrug
- avitapharmacy-brea-125
- enterprisesvcs-test
- greensboropharmacy
- harbordrug
- kratzershometownrx-middletown
- marketplacepharmacy-rockhill
- medicenterpharmacy-carbondale
- pharmvilledrug
- riesbeckspharmacy-cambridge
- themedicinestore
- utprimarycareseviervillerx
- vascorx
- revelationwholesale
- qvspharmacy
- cornerstoneapothecary-marengo
- elliottplazapharmacy
- expressrx-saintjoseph
- northparkpharmacy
- sinksrx-corporate
- southsiderx-springhope
- sweetgrass-mtpleasant
- vitalcarepharmacy-littlerock
- pilchermcbrydedrugco
- chateaudrug
- dougsfamilypharmacy
- eriepharmacy
- foothillsprofessionalpharmacy
- greenbaumspharmacyinc
- hawthorne-winnsboro
- neighborhoodconciergerx
- northshorechemists
- peopleandpets
- roanmountainpharmacy
- siegelspharmacy
- sweetgrass-greenville
- universalrx
- vow-draketest
- westcoastrx
- peoplesrx-2
- allcarerx
- coasthillspharmacy
- expressrx-tunica
- frontierfamilypharmacy
- goldenstatepharmacy
- holycitypharmacy
- hometown-georgetown
- idealhealthmart
- medicalcenter-rockingham
- mondovipharmacy
- munseypharmacy
- piedmontpharmacy
- riversidevillage
- stamantpharmacy
- wannamakerdrug
- tts-api-prod
- perkinsfamilypharmacy
- abramsroyalpharmacy
- carepharmpharmacy2
- harborhealthandapothecary
- henriettarx
- islanddrug-1145
- koblinspharmacy
- linskypharmacy
- lumbertondrug
- martinsburgpharmacy
- medicineshoppe-shillington
- sheefapharmacy
- swanserv-upharmacy
- hotspringspharmacy
- actonvalepharmacy
- adamsdrugs-perryhill
- ashlyn-drug
- blairpharmacy
- brightoncommunitypharmacy
- carispharmacy-2
- goodgracespharmacy
- kellyspharmacy-delmare
- medicineshoppe-santarosa
- memorialhallandalerx
- quessrx
- thepharmacyatoceansprings
- u-saveitrx-southalbany
- vitalcare-greensboro
- whitesvillerx
- witmerdrugstore
- qvspharmacy-2
- backhomepharmacy
- blountsmutualdrugs
- bluegrassdrug-bedford
- durenpharmacy
- gooddayrx-longmont
- haworthapothecary
- lincolndrugs
- medicalassociatespharmacy-boone
- medicineshoppe-cloquet
- northportpharmacy
- peoplesdrug-lexington
- salidapharmacy
- sinksrx-vienna
- thepharmacyofshannonhills
- u-saverx-richland
- vitalcareofhagerstown
- avitapharmacy-philly
- avitapharmacy-sanantonio
- clinicalmanagementconcepts
- familyrx-milan
- kirksvillepharmacy
- rosedrugofclarksville
- stjosephpharmacy
- wellnesspharmacy-batonrouge
- palmcare-elcajon
- desertlifepharmacy
- auburnpharmacy-concordia
- baldwinwoodspharmacy
- bayarx-east
- burtspharmacy-newburypark
- careplus
- cheekandscott-liveoak
- fivemin-waipahu
- hartfordpharmacy
- harvestpharmacy
- healthyway-sandyhook
- nowatacitydrug
- poetssquarepharmacy
- ridgecrestpharmacy
- rxinnovations
- communityrx-monroe
- conwellspharmacy
- elginrx
- greatercarepharmacy
- lincolnspecialtypharmacy
- losfresnospharmacy
- medicineshoppe-whiting
- melrosepharmacy
- modestopharmacy
- moultrieatcaddo
- radcliffpharmacy
- realtime-socket-server-centos
- woolmarketrx
- beddingfielddrugs
- altruchemists
- arrowpharmacy-carrollton
- brooknealdrugs
- cobornsrx-2043
- crivitzpharmacy
- easttallasseepharmacy
- expressrx-ottercreek
- highlandpharmacy-glasgow
- mercymedicalcenter
- phillipsfamilypharmacy
- preferredcherokee-dalton
- rosauerspharmacy-39
- southpointepharmacy
- themedicinecabinet-marksville
- vowuniversity3
- wendelldrug
- c-proxy.dev
- applerx-lynwood
- avitapharmacy-missionviejo
- bidwellpharmacy
- cherokeehealth-knoxville
- debbiespharmacy
- edgertonpharmacy
- hochunkhealthcarecenter-pharmacy
- phelpscountyregional
- quinlanspharmacy-montour
- rawlspharmacy
- southwesthealthsystempharmacy
- thepharmacyatrmc
- centralvalleypharmacy
- ahspharmacy-lumberton
- bandysrx-waynecity
- castlemountaindrug
- centraldrugstore
- cobornsrx-2001
- cobornsrx-2002
- drexrx
- easternstatescompoundingrx
- elmerdrugs
- lacpmqpharmacy
- lillianpharmacy
- medicarx-springfield
- priority-health-care
- woolmarketpharmacy
- avitapharmacy-charlotte
- clevelandmedicineshoppe
- cornerstone-conway
- cwp-westboca-0764
- eltejonpharmacy2
- friendlycitypharmacyon2nd
- klingensmithsdrugstores-leechburg
- kratzershometownrx-lynchburg
- kremerpharmacy-ii
- medicap-8160
- medicap-8347
- medicineshoppe-maxton
- medisavepharmacy
- nationscarepharmacy
- ocracokehealthcenterpharmacy
- pellaregionalhealth
- seasidepharmacy
- shriverspharmacy-crooksville
- sinksrx-bourbon
- southholdpharmacy
- arlington-pharmacy
- bayapharmacyeast
- drugco-express
- hayatrx-hq
- hayspharmacy
- medicineshoppe-1500
- oakhurstpharmacy
- palmerpharmacy
- pelicandeliveryrx
- ritevaluepharmacy-louisa
- starkpharmacy
- triondrugs
- wilsoncommunityhealthcenterrx
- avitapharmacy-florence
- broadwayhealthpharmacy
- conlinspharmacy
- cwp-suncoast-2e85
- davisbrothers-newcumberland
- delta-iop
- dogwoodpharmacy-nashville
- farmvillepharmacy
- lassendrugco
- morristownpharmacy
- planopharmacy
- preferredrx-costamesa
- sandrdrugcompany
- gracepharmacy
- medicalcourtpharmacy
- avitapharmacy-nashville-1070
- bestvaluerhomerx
- citydrugstore-presqueisle
- codysusavepharmacy-auburn
- healthaidpharmacy
- kirks-sunrise
- medicineshoppe-1088
- northtowndrug
- realodrugs9
- reddingdrug
- northmainpharmacy
- adamsdrugs-central
- allhealthnetwork
- bakercitypharmacy
- cobigelowchemists
- forwardpharmacy-monona
- k-packpharmacy
- medicalcenter-savannah
- medicalpavilionpharmacy
- midlandmedicalcenterpharmacy
- premiercarepharmacy-2
- redrockpharmacy
- rite-valuepharmacy-inez
- thomasdrug-gordon
- whitmanpharmacy
- douglaspharmacy
- invictuspharmacy-mailorder
- browndrug-palmyra
- acrxspecialtypharmacy
- hallerspharmacyandmedical
- premiernewportricheypharmacy
- professionalartspharmacy
- riveroakpharmacy
- rollingforkdrugs
- sav-morpharmacy-virden
- alpspharmacy
- andrewspharmacy-ky
- bathdrug
- blancharddrug
- capsulepharmacy
- clarkcountypharmacy
- clarkprofessionalpharmacy
- colstripfamily-mt
- dalcomaspecialtyrx
- fusionmedical
- hocks-medical
- infinitypharmacy-cookeville
- maplepharmacy
- medicap-8051
- mesquiteemployeehealthrx
- metrowestpharmacy
- mrsipster
- parkplacechemists
- portlandrx
- priorityhealthcare-gretna
- starlingpharmacy-ii
- stoneoakrx
- techeactionclinicrx-morgancity
- valleypharmacy-derby
- accessprimepharmacy
- cobornsrx-2027
- equityrx
- harmonsdrugstore
- kings-pharmacy
- markspharmacy-sylva
- quickrxdrugs-springfield
- rawlsrx
- rogers-moundcity
- seaviewpharmacy
- sierraspecialty
- windsorcommunityhealthcenterpharmacy
- adkinspharmacy
- baronsdrugstore
- bertspharmacy
- clinchvalleypharmacy
- communityhealthalliance-pasadena
- cwp-elite-pembrokepines
- farmaciareyes2-parana
- icarepharmacy
- medicineshoppe-1822
- mountainlandsfamilypharmacy-provo
- omnifamilyhealth-shafter
- partnerspharmacy-lakemary
- qchc-rx
- rosecitydrug
- techeactionclinicrx-houma
- ameliapharmacy
- avitapharmacy-batonrouge
- cambridgehealthalliance-hospitalcampus
- centos7test
- colerhealthcare-dme
- communitycareclintonpharmacy
- dalessouthlakepharmacy
- downtowndiscountdrugs
- helenhunthealthcenter
- highlanddrugsllc
- hinesvillepharmacy
- legacyspecialtypharmacycorp
- medicalpharmacy-west-zachary
- medicinepark-sanford
- nucarapharmacy-grundycenter
- plattevalleypharmacy
- prestonscompoundingpharmacy
- razooksdrug
- vitalcareoforlandpark
- hodgemancountypharmacy
- syedpharmacy
- fuquaypharmacy
- aghrediscriptspharmacy
- blackbearpharmacy
- expressrx-fayette
- gurdonpharmacy
- howardfamilypharmacyofeastern
- professionalrx-caledonia
- upstatefamilydrugs
- westexpharmacy-odessa
- yubacitypharmacy
- repo
- rosauerspharmacy-27
- publicdrugcorx
- advicarepharmacy
- burtspharmacymoorpark
- camachopharmacy
- charlesrivercommunityhealth
- cherokeecustomscriptpharmacy
- cpn
- fergusonrexall
- neighborhoodfamilypractice-puritas
- newhavenpharmacy
- nvrpharmacy
- oakgroverxexpress
- shieldspharmacy
- shopandcarrypharmacy
- shriverspharmacy-corporate
- cwp-okeechobee-f512
- alwanpharmacy
- avitapharmacy-1084-dothan
- checotahclinic
- frenchspharmacy-morton
- heidispharmacy
- ledfordrxexpresspharmacy
- olivetreecompoundingpharmacy
- psa-rockymount
- stanleyspecialtypharmacy
- stephenspharmacy-honesdale
- ulrichsvalleypharmacy
- vinepharmacy
- actonvalerx
- citizenpotawatomination-west
- coquilleindiantribepharmacies
- corvallispharmacy
- dentonprescriptionshop
- lifetimepharmacy-allen
- mccookspharmacy
- mcdowellspharmacy
- nativeprojectrx
- onu-edu
- potterdrug-4
- villagepharmacyoflockport
- budgetdrugs
- demo-dp
- dynamiccarepharmacy
- hinasmercysouthwestrx
- hometownpharmacy-springfield
- jordanpharmacy
- pricechopperpharmacy-6
- shriverspharmacy-nelsonville
- thedrugstore-norway
- westsalempharmacy
- wireless-one
- arnoldprofessionalrx
- bandysrx-centralia
- chinookpharmacy
- communitymedicalcenterpharmacy
- curtis-washington
- evansprescriptionpharmacy
- hmcpharmacy-holyoke
- houstoninfusionservices
- infinitypharmacy
- ionepharmacy
- kirks-eatonville
- puccipharmacy
- realodrugs4
- u-saveitrx-cordele
- clarksrxthecompoundinglab
- andersonpharmacy
- cfh-leakesville
- chehalispharmacy
- ihs-metter
- martellaspharmacy-franklinst
- maxbrownpharmacy
- my
- readinghospitalambulatory
- whitesellspharmacy
- medicineshoppe-york
- medsyourway
- accapothecary
- blancopharmacy
- easternsav-mordrugs
- genscripts-glenpool
- leachvillediscount
- medicineshoppe-greenvilletx
- mmhhometownpharmacy
- nucara-valleycity
- okeechobeediscountdrugs
- phillipspharmacy
- schulz-wroten-rx
- shippsdiscountpharmacy
- swainspharmacy
- u-saveitrx-pionono
- westcarepharmacy
- wilmingtonpharmacy
- burkesnewriversidepharmacy
- entmeds
- healthinnovations-laurinburg
- hibbitts-sc
- jandlpharmacy
- matthewspharmacy
- moffetdrug
- plainviewpharmacy
- sunlifepharmacy-oracle
- timspharmacy-ga
- yeesprescriptionpharm
- 15rxpharmacy-1
- apothecarepharmacyv-mulberryst
- poretsthriftywaypharmacy
- silercityrx
- aandapharmacy-belzoni
- brownspharmacyandgifts
- capecodhealthcare-falmouthhospital
- drugcenterpharmacy
- hayatrx-1
- herolds-westashley
- moscosopharmacy
- newmadridpharmacy
- riverview-ipsec
- seaportcommunityhealthcenter
- theapothecaryshop
- waterfrontpharmacyltc
- hickorydrug
- websterspharmacy-altadena
- communityhealthcare-spanaway
- advancedmedmanagement
- alphapeoplesdrugs
- caldwelldrug-columbia
- centraloklahomafamilyrx-konawa
- coalgrovepharmacy
- condopharmacy
- delta-daniel-island
- digital-avacarepharmacy
- eaglepharmacy-lindale
- futrellpharmacy
- granitepharmacy-frenchtown
- healthfirstpharmacy
- kexrxpharmacy-atchinson
- linospharmacy-2
- medicineshoppe-1468
- puntagordamedicineshoppe
- comprehensivecarepharmacy
- firstchoicepharmacy
- genscripts-owasso
- handahealthpharmacy
- heartoffloridahealthcenter-villages
- jacksonrx
- khourypharmacy
- longbelladrugbylakewood-staplesclinic
- lyonspharmacy
- northfloridarxoffortwhite
- northwestcommunitypharmacy
- prontopharmacy5
- realodrugs20
- sarahcarerx
- skillzcarepharmacyinc
- thepharmacyatstpatricks
- expressrx-seminary
- paysonrx
- perkinsdrugs2
- westdrug
- walldrugsofflorence
- embracepharmacy
- cloneyslongtermcare
- gatewaypharmaceuticalsrx
- isakcomputing
- northstarpharmacy
- readinghospital7thavenuepharmacy
- staffingassociates
- 8thavenuepharmacy
- amberwellpharmacy-hiawatha
- erinlongacc
- expressrx-miami
- grahamrx-midland
- idealmarket-11
- kaweahhealthemployee
- kirkwoodcorp
- memorialmiramaroutpatientrx
- springhillfamilypharmacy
- stenniscommunitypharmacy
- unadilladrugco
- weslacopharmacy
- bestvaluecountrydayrx
- clarionmedicineshoppe
- expressrx-coweta
- familyhealthcenter-denmark
- familywellnesspharmacy
- garnerfamilypharmacy
- goldencovepharmacy
- hayatrx-23
- islanddrug-1142
- jamestownpharmacy
- jolleysrx
- lefavepharmacy
- macdonaldspharmacy
- multnomah-midcounty
- myrtledrugs
- picayunedrugcompany
- price-riterx
- rabinowitzpharmacy
- sheridanfamilypharmacy
- stbernardsmedicalcenter
- sunrisepharmacy
- citydrugofbrady
- jandnpharmacy
- annamedicenterpharmacy
- bachpharmacysouth
- bouvierpharmacy
- braswelldrugs
- dillesdiscountpharmacy
- drugco-roanokerapids
- jacksdiscountrx
- lovelockpharmacy
- parklandrx-farmington
- thompsondrugdowntown
- westhartfordapothecary
- palisadepharmacy
- argopharmacy
- betterlifepharmacy-elcajon
- citydrug-cheyenne
- communitypharmacyoflakeview
- dunloprx
- expressrx-cabot
- familyhealthpharmacy-versailles
- familypharmacyfulton
- hayatrx-20
- icsrx
- lakelandrx-willowsprings
- nfpmedcenter
- porterspharmacy
- puppetcompiler2
- realodrugs-trenton
- sutherlindrug
- firopharmacy
- cambridgehealthalliance-malden
- lanningpharmacy
- mainline-rx-ebensburg
- neighborhoodcarepharmacy
- riverviewhealthrx-westfield
- rodensmith
- puppetcompiler3
- lifescriptpharmacy
- medicap-8435
- omnifamilyhealth-stine
- pellaregionalhealth-prairiecity
- bramehuiepharmacy
- colonvillagedrug
- dailydosedrugstore
- guyspharmacyofhazlehurst
- hancockpharmacy-albion
- hangerdrugs
- lapharmacy
- avenuepharmacy
- accesshealthpharmacy-beckley
- elydrugs-bowlinggreen
- formulationcompoundingcenter
- harvestfamilyhealthcenter
- lakecountrycompounding
- laketownpharmacy
- medicap-guyton
- medicinebin
- mymedpharmacy
- raleighpharmacy
- thewoodlandscompoundingpharmacy
- tillamookpharmacy
- medpluspharmacy
- castorpharmacyandsurgicalsupplies
- aandapharmacy-hwy1
- hixenbaughsdrugstore
- kratzershometownrx-maineville
- lowrydrugsandgifts
- medicinemanpharmacy-springhill
- morganrx-springfield
- nucara-hawley
- premierdrugstore
- priceritedrug
- rxclinic-3
- univofkansas-westwoodcancercenterretailrx
- bristoldiscountpharmacy
- buyritedrugs-broad
- etown-vitalcare
- expressrx-pleasantview
- highlandscommunitypharmacy
- invictuspharmacy-livingston
- lincolnpharmacy-tacoma
- nucarapharmacy-ames
- polkpharmacy
- riverroadhealthmartrx
- tequestadrugs
- trailcreekpharmacy
- somcpharmacy-westunion
- ariacommunityhealth
- anthony-brownpharmacy
- avitapharmacy-lexington
- backup
- beverlyglenpharmacy
- chesterriverpharmacy
- debrepo
- esterbrookpharmacy
- galenpharmacy
- gemdrugsgramercy
- hometownhealthcare
- johnspharmacy
- kentstationpharmacy
- lakemurraydrug
- nightingale-monticello
- ourhomerx-blairsville
- openswan
- bannerdrug
- bentonharborcommunitypharmacy
- maplerx
- medicineshoppe-granby
- munfordpharmacy
- oxnarddrug
- parkcirclepharmacy
- pikespharmacy
- preferredpharmacy-benton
- reedhutchinspharmacy
- reverehealthpharmacy
- andersondrugs
- apthorppharmacy
- arrowprescriptioncenter-12
- barondrugs
- buyritedrugs-eufaula
- houseofwellnesscenter-pharmacy
- marketimedrug
- mountainviewrx
- pearmanpharmacy
- rosemontpharmacy
- signaturehealthcarepharmacy-eb
- wilsonpharmacy
- lakewyliepharmacy
- altru-pharmacy
- bryanpharmacy-elba
- byrddrugcompany
- grahamrx-north
- greenspointpharmacy
- maloneyprescriptionpharmacy
- mastpharmacy
- sarapharmacy
- thompsons-neighborhoodrx
- trummdrug-elbowlake
- adaapothecary
- almands-sunset
- cashwiserx-3015
- cwp-whaven-1e98
- dolsontownpharmacy
- eastberlinpharmacy
- greenbrierrxandfountain
- marketplacepharmacy
- marsdenpharmacy
- martindrugsofriverhead
- nationwiderx
- ostromsdrug
- pratersrx
- sav-morpharmacy-nokomis
- sebastopolfamilypharmacy
- snipharmacy
- thriftymacdiscountdruginc
- valleydrugs-winston
- vitalcare-tacoma
- wallsmedicine
- windhamrxnorth
- www
- applediscountdrugs-clinton
- brokenarrowfamilydrug-north
- clinicrx-boone
- cwp-ncongress-f510
- elizabethsrx
- johnspharmacy-altenburg
- kaup-dme
- lvinfusionandspecialty
- martinspharmacy
- pextonrx
- pleasanthilldrug
- quinnsfamilypharmacy-newton
- texasscripts
- villagepharmacyandwellness
- wilkinsonpharmacy
- youngspharmacyandgeneralstore
- andersoncrossingrx
- monfortfamilyclinic
- pharmavidarx
- iconpharmacy-lagunahills
- a-1pharmacyhammond
- apothecarepharmacy-cardinal
- bestvaluehicopharmacy
- boiesmedicalcenterpharmacy
- carterdrugcompany
- chasedrugsandclinicalservices
- coloniacarerxandcompounding
- healthcenterrx
- integrityrx-monmouthjunction
- lifepharmacy
- medicap-glenpool
- meierrx
- mountainlandsfamilypharmacy-wasatch
- neilspharmacy
- nostrumrxpharmacy
- pinnacleapothecary-candler
- realodrugs-veterinary
- realodrugs23
- ryteshpharmacy
- sandpointsuperdrug
- scottsquitmanpharmacy
- 5thavenuepharmacy
- cambridgehealthalliance-eastcambridge
- cobornsrx-2034
- culinarypharmacyiii
- desmoinespharmacy
- hooverdrug
- klingensmithsdrugstores-rimersburg
- lawrencememorialhospital
- pavilioncompoundingpharmacy
- portalleganyrx
- prosperityhealthpharmacy
- rockymountainpharmacy
- sandjmedicalcenterpharmacy-decatur
- villagepharmacy-portales
- seniorlifepharmacy
- jandjpharmacy-cedarlane
- allenfamilydrug
- almands-tarborost
- boonememorialoutpatient
- coleescornerdrugs
- communitypharmacyofgowrie
- integratedhealthcarerx2-aop
- jeffsprescriptionshop
- juliantpiercehealthcenter
- rxpharmacy
- savencarepharmacy
- texasroadrx-oldbridge
- weavervillepharmacy
- wellpackpharmacy-mountdora
- alliancefamilyhealthcenter
- ashlandcitypharmacy
- carepluspharmacy
- dropletfileserver
- fivemin-pearlcity
- genscripts-brokenarrow
- notredamepharmacy
- plumstedpharmacy
- poconopharmacy
- rexdrugco
- stalbanspharmacy
- waylandvillagepharmacy
- whitesvillemedical
- medicalartspharmacy
- staging.dev
- accesshealthpharmacy-princeton
- aplusfamilyhealthcare
- arnzenskamiahdrug
- auburndalepharmacy
- avitapharmacy-brownsville
- eurekadrug
- lakelandrx-crane
- liveandletlivepharmacy
- medicineshoppe-knoxville
- nunallydrugstore
- proxsysrx-corporatespecialty
- teamsterscarerx
- villagerx-hampstead
- circlevilleapothecary
- genscripts-southtulsa
- illuminz
- islandpharmacy-ketchikan
- mitchellsdrugstore-uptown
- summersrx-marshall
- totalpharmacyservicesinc
- arwood-drugco
- midwestcompounding
- sbrospharmacy
- allenspharmacy
- barriofamilyhealth
- expressrx-ripley
- loganhealthpharmacy-columbiafalls
- medicap-8015
- redstickpharmacy
- optimumwellnesscenter
- avitapharmacy-lafayette
- barrspharmacy-blanchester
- cornerstone-gentry
- crosskeyspharmacy
- hiltonheadpharmacy
- jameshunt
- kayrx
- kingsdaughtersrx
- ligonierpharmacy
- medsave-wilmore
- omnifamilyhealth-delano
- springvillepharmacy
- tmt-mgmt
- waterfordpharmacy
- digital-delta-monckscorner
- crossroad-wylie
- bertrampharmacy
- currenpharmacy
- fourthavenuerx
- pattersonhealthcare-abilene
- wasemspharmacy
- whitemountain-showlow
- apothecare-leesville
- group2
- happypharmacy
- healthsmart-mooresville
- louismorgandrug4
- riverviewoutpatientpharmacy
- send1.fax.dev
- stonescornerpharmacy
- tinrxatthetower
- u-saveitrx-phenixcity
- greenriverpharmacy
- optumrx-nationwide
- auburnpharmacy-camdenton
- bascomspecialtypharmacy
- bloomsdalepharmacy
- bluhavenhealth
- customedicapharmacy-eagle
- drugco-tarboro
- expressrxandmedsupplies
- gentrypharmacy
- healthcopharmacycorp
- lexingtondiscountdrugs
- ltcprescriptionproviders
- medicapltc-8405
- nucara-conrad
- pioneerpharmacy
- stephaniesdownhomerx
- test-mm
- villagerx-glenwoodcity
- emeraldhillspharmacy
- lifetimepharmacyandcompounding
- thriftydrugstores
- u-saverx-gretna
- barrefamilypharmacy
- freelandbrownpharmacy-3
- murraysdrug-condon
- parkewarnerpharmacy
- parksidecompoundingpharmacy
- reedspharmacy-hyrum
- reedspharmacybrookville
- staytonpharmacy
- thecornerdrugstore
- vitalcareofmequon
- vitalscript
- andersonpharmacy-manning
- adlerspharmacy
- betterlifepharmacy
- delta-elloree
- elktonfamilyrx
- gilchristpharmacy-mynatt
- grayslakeapothecary
- hedgeshealthmartpharmacy
- lewistownpharmacy
- lindstromthriftywhitepharmacy
- marketstreetpharmacy
- pharmacyplus-usf
- rileywhitedrugs
- skylinepharmacy
- sunlifepharmacy-casagrande1
- westsidefamilypharmacyllc
- alexrx
- avitapharmacy-bakersfield
- barneyspharmacy
- brianspharmacy
- communityrx-sterlington
- kempfamilypharmacy
- medicineshoppe-saraland
- medicspharmacy
- moultriepharmacy-langtown
- oneals-columbia
- surecarespecialtypharmacy
- trinityspharmacy
- communitypharmacy-nashvillehospital
- familypharmacy-frontroyal
- friendhealthpharmacy
- martellaspharmacy-parkhill
- medicinemanpharmacy-wahoo
- moorespharmacy-sinton
- pharmaxpharmacy-festus
- puyalluptribalhealthauthority
- theatrepharmacy
- trinh-pharmacy
- watertownpharmacy
- davisdrugcompany-benson
- medicap-8318
- southbrunswickpharmacyinc
- gastonfamilypharmacy
- lakepharmacy-clearlake
- familyrx-swansboro
- genesispharmacyservices
- henryjaustinpharmacy
- jacksonmedicenterrx
- lakindrug
- lifetimepharmacy-frisco
- medicap-olyphant
- prescriptiondrugstore-caruthersville
- scottdrugs
- uandipharmacy
- whartonpharmacy
- communityhealthcare-eastside
- centerpharmacy-capecoral
- hmupharmacy
- integrityhealthrx-brick
- madisonhealthmartpharmacy
- washingtonhealthmart
- citydrug-maryville
- citypharmacyofjunction
- drex-yadkinville
- east-tn-discountdrug
- healthdepot-3
- hendersondrugs
- hometownpharmacy
- marionmedicineshoppe
- medicap-8095
- thorncherryrx
- waldendrug
- economypharmacy-tulsa
- oakridgepharmacy
- bathcommunitypharmacy
- bayarx-west
- delmarpacking
- fivemin-ltc
- halecenterrx
- harlesscenter
- lanedrugco
- macspharmacy-townsend
- rannpharmacy
- tahlequahdrugco
- thecompoundingshoppe
- tinrx-806
- valuemedpharmacy-paintsville
- bestrx-test
- catalystrxpharmacy
- evansdrugs
- lovesrx-oceansprings
- okawvillemedicenter
- oldbridgeandsurgicals
- omnifamilyhealth-newwasco
- oxnardmedicineshoppe
- rainespharmacy
- riversidepharmacy-easthartford
- springvalehealthcentersrx
- steelevillerx
- avitapharmacy-1001-losangeles
- travsu-savepharmacy-genoa
- neighborhoodfamilypractice-abr
- hintonhealthexpresspharmacy
- murrayvillepharmacy
- avitapharmacy-atlanta
- belvederepharmacy
- d-rexpharmacy-yadkinville
- dandhdrugstore-paris
- delta-monckscorner
- familyrx-ky
- hayatrx-12
- medicappharmacy-8123
- rosauerspharmacy-10
- schaffnerpharmacy
- expressrx-webbcity
- mainline-rx-altoona
- medicalpharmacy-locust
- redoakmedicap
- slavins-hancockpharmacy
- sunraypharmacy-bayshore
- haeckervillerx
- hillsboroughpharmacync
- medicinecenter-dunn
- christushealth
- cobornsrx-2033
- collegecarepharmacy
- fax.ondoapis
- forwardpharmacy-cottagegrove
- littleacornrx
- sandjargylepharmacy
- trummdrug-main
- aandapharmacy-southmain
- davisbrothers-newcumberland2
- georgetownpharmacy
- hackensackmeridianvillagerx
- hunterrx
- laurelrx1
- medicap-raleigh
- medicarx-lakemary
- nucara-paynesville
- parkerspharmacy
- parkhurstpharmacy
- sav-morpharmacy-cerrogordo
- trivilliansrx
- summitspecialtypharmacy
- ellisnottstreetrx
- heartland-mansfield
- medicinemanpharmacy-mainstreet
- padekhealthcarepharmacyii
- pulaskipharmacy
- quickpharmacy
- trullfamilypharmacy
- vitalcareofprinceton
- eric-test
- heidispharmacy-wooster
- levis
- pharmacyplus-paterson2
- preckshotprofessionalpharmacy
- ricksdiscountdrugs
- sinksrx-steelville
- whitleypharmacy
- wil-savdrugs-sweetwater
- hollyparkpharmacy
- bearlakedruggardencity
- cape-raefordroad
- coxsvarietyandpharmacy
- hoganspharmacy
- hoodspharmacymedicineshoppe
- integrativepharmacyandwellness
- marketrx
- mcneasedrugs
- medicenterpharmacy-cambridgecity
- midtownpharmacy-kearny
- omnifamilyhealth-butlerfresno
- prescriptionpadpharmacy
- riversidepharmacy-salisbury
- stegenevievepharmacy
- whidbeyhealthcommunityrx
- thepharmacyatsingingriver
- ayerfamilypharmacy
- cherokeehealth-alcoa
- omnifamilyhealthnewpanamagrove
- optimalpharmacy
- powerscompoundingpharmacy
- puppet
- quickmedspharmacy
- southlandpharmacy
- stvincentspharmacy-birmingham
- andyspharmacy-cookeville
- atholpharmacy
- bayvillepharmacy
- cannondrugs
- cobornsrx-2035
- friendlyrx
- greenemedicalarts
- hollandcommunitypharmacy
- northernpharmacy
- sunlifepharmacy-apachejunction
- thrift-townhealthmart
- cabrillopharmacy
- cannonrx-salisbury
- cascadespecialtyrx
- chaircityrx
- dchsretailpharmacy-florence
- delcodrugs
- edgemontpharmacy
- fanninpharmacy
- gatlinmedicalartspharmacy
- jolleyssandypharmacy
- laurelrx2
- medicap-8036
- medicap-8247
- medonepharmacy-newmarket
- modernpharmacyincorporated
- pharmacy1-elcajon
- piggottrx
- sierrapharmacy
- specialtyrxcare
- striplingspharmacy
- thepharmacy
- saintmatthewspharmacy
- digital-clevelandpharmacy-madera
- buywisedrugs
- farwellhealthcenterpharmacy
- healthworkspharmacy
- iconpharmacy
- infuserveamericainc
- pharmcarerx
- scheerdrugs
- starpharmacyandgifts
- themedicinecabinet-2
- tmcpharmacy
- pittsfieldpharmacy
- coltonpharmacy
- cape-ramsey
- clevelandpharmacy-madera
- genevapharmacy
- inoladrug
- remingtondrugco
- theprescriptionpad-fruitland
- westonpharmacy
- boydsdrugmart
- hallscaremartpharmacy
- hawthorne-lugoff
- lifelinespecialtypharmacy
- sunlifepharmacy-casagrande2
- tinrxlatimerspharmacy
- vandeldrug
- woodrivermedicine
- bluestonepharmacy
- communitycarepharmacy-lewisville
- familychoicepharmacy
- impactcompounding
- nashvillehealthcarepharmacy
- solacecarepharmacy
- westernnccommunityhealth
- woodlakespharmacy
- chetjohnsondrugsinc
- vitalcareofsyracuse
- truecompoundingpharmacy
- brysoncitypharmacy
- dannysrx-2
- expressrx-hope
- instantrx
- oquirrhmountainrx-westvalley
- sms-voice-responder
- stmarypharmacy-chatsworth
- uptonpharmacy
- vitalcare-guilford
- bayapharmacywest
- brissondrugs
- suncrestpharmacy
- broadwayfamilypharmacy
- brocktonpharmacy
- communityclinicofhighpoint
- cornerdrug
- couchrx-sheridan
- kramerpharmacy
- lilboospharmacy
- medicalpharmacy-albemarle
- morrisplazapharmacyandsurgicalsupplies
- qwikmed
- syedintegrativehealth
- auburnpharmacy-burlington
- betterlifepharmacy-southriver
- blackriverfallspharmacy
- cobornsrx-2030
- communityhealthcenterpharmacy
- crossroads-menlo
- doughertyspharmacy-dallas
- gerouldsrx-2
- hometownrx-springfield
- jacob-test
- medtownpharmacy
- paxpharmacy
- peopleshealthcenterrx
- pharmacyplus-whitehall
- rectordrug
- thedrugstore
- timberlinepharmacy
- diketsprofessionaldrugs
- eastsidepharmacy-lawton
- fostershealthmartrx
- goldenislesrx-2
- integrityrxpharmacy
- kaizencompoundingpharmacy
- kelley-rosscompounding
- kizerpharmacy
- marionrx
- newportpharmacy
- rocklandpharmacy
- salmonpharmacy
- trianglepharmacy
- univofkansas-indiancreek
- urgentpharmacycarellc
- genewellpharmacy
- gpspharmacy
- philshealthmart
- uphamscommunitycarepharmacy
- eaglepharmacy
- fouchandsonpharmacy
- hayatrx-4
- mattsonpharmacy
- pharmaprodia
- prescriptionstogo-2
- tackettcompoundingpharmacy
- unioncommunitycare-dukestreet
- clarkdrugs
- elvington-drug
- fievetpharmacy
- horshamsquarepharmacy
- kelley-ross-polyclinic
- lufkinpharmacy
- nyspharmacy
- santabarbaramedicineshoppe
- stapleypharmacy-downtown
- vytosrx-hammond
- whitemountain-overgaard
- yrmcfoothillspharmacy
- farmaciadelpueblo-elcentro
- wesleysdev-fluent
- altru-fmr
- beringerdrugcenter
- burlingtonpharmacy
- cobornsrx-2039
- gull-point-pharmacy
- kellyspharmacy-centralfill
- molloysmedicalarts
- shakamakpharmacy
- starcarepharmacy-prosper
- towndrugs
- syracuseuniversityhealthservicesrx
- c-proxy
- andrewspharmacy
- citydrugstoreofhendersontninc
- communitymedicinepharmacy
- countrysidepharmacy
- cwp-ormondbeach-1b40
- drillingmorningsiderx
- familyrx-allegroplaza
- gallaherspharmacy
- guysfamilypharmacy
- matteshealthmartpharmacy
- mountvernondrugcompany
- pattersonhealthmart-claycenter
- waukamountainpharmacy
- sandersdrugs
- clinicpharmacy-toccoa
- davidcitydiscountpharmacy
- dottiespharmacy
- granitepharmacy-philipsburg
- martinspharmacy204
- medicap-8432
- medicap-cascade
- norfieldmedicalcenterpharmacy
- prosperitydrugcompany-batesburg
- rexpharmacy
- trinitydiscountdrugs
- chateaudrugsinc-metairie
- limestonedrug
- mcmahanpharmacy
- proscriptpharmacy
- saltillopharmacy
- terrydrugs
- thriftwaypharmacy-classon
- vowuniversity10
- hometowndrugennis
- advancesjpharmacy
- cwp-orangecity-3a64
- eufaulapharmacy
- gdnpharmacyllc
- healthheropharmacy-wellpointe
- lawrencedrug-springfield
- ocalapharmacy
- pelphreypharmacy
- richmondhillpharmacy
- southsiderx
- valleyintegratedpharmacy
- whittierhealthrx
- nucara-greenfield
- mountainlandpaysonrx
- bobjohnsonspharmacy
- anawanpharmacy
- avenelpharmacy
- barbeepharmacy
- barronhometownpharmacy
- bridgecarepharmacy
- cambridgehealthalliance-specialty
- carpenterdentdrugs
- castlepharmacy
- menifeecountypharmacy
- monettediscount
- gurleyspharmacy
- carrollrx-clay
- colerltc
- familycarerx
- lakelandrx-branson
- mikesrx-2
- newlondonpharmacy
- robbinsvillepharmacy
- sids-pharmacy
- rosauerspharmacy-03
- avitapharmacy-losangeles
- beaufortpharmacy
- brian-ivr
- firesidepharmacy
- healthparkrx-mtpleasant
- kwikrxpharmacy
- medicinemanpharmacy-schuyler
- prescriptioncenterofossining
- reedspharmacy5-berryville
- westminsterpharmacyservices
- ackalspharmacy
- buddpharmacy
- medicap-toledo
- paulsensrx
- potterdrug-petersburg
- summersrx-sedalia
- vow-lab
- walpolepharmacy
- arcare
- babispharmacy
- clarksbigcountryrx-delivery
- cobornsrx-2047
- gilchristpharmacyinc
- goodrichpharmacyltc-anoka
- harleyvilledrug
- healthheropharmacy-rochesterhills
- pharmacyspecialtiesandclinic
- browndrugcompany
- cashwiserx-3014
- centralpharmacy-haslett
- cobornsrx-2024
- crossroadsspecialtypharmacy
- eastovercooprx
- gemdrugsreserve
- gooddayrx-eaton
- hayatrx-3
- loudounpharmacy
- medicalparkrx-newport
- mortoncomprehensivehealth
- truepharmacy-devine
- ahmarx
- arrowpharmacy-rome
- asbellpharmacy
- bandkprescriptionshop
- chancydrugs-lakepark
- christmaspharmacy
- currypharmacy
- harvardneighborhoodrx
- healthshoppharmacy
- lifestreampharmacy
- medicineshoppe-rexburg
- sinksrx-sullivan
- stjohnshealth
- summersrx-nevada
- thomasdrug-broad
- a1pharmacy
- angelopharmacy
- auburnpharmacy-eudora
- betterhealthrxcorp
- cascadiapharmacy
- culinarypharmacyii
- expressrx-paris
- horseshoehealthandmedicine
- howardfamilypharmacyofallen
- juneaudrugcompany
- lepantodiscount
- longliferx2
- marshallpharmacy-proact
- martinlutherkingpharmacy
- medicap-8207
- oakhurstrx
- realodrugs8
- smithssthelenapharmacy
- solutionspharmacyinc-ooltewah
- spencesmedicalcenterrx-angleton
- sterlingpharmacy-mtsterling
- valleywellnesspharmacy
- alliancecommunitypharmacy
- baldwinpharmacy
- coolidgepharmacy
- daniels-barnwell
- haddypharmacy
- hayatrx-10
- hilltopmarketrx
- macespharmacy-belington
- parklandrx-fredericktown
- pharmacyplus-girard
- smithspharmacy
- southcountymentalhealth
- wallyshongpharmacy
- boydspharmacy-pemperton
- lackiedrugstore
- lincolnplacepharmacy
- marshallpharmacy-mumc
- medicinemanhaydenpharmacy
- pasteurpharmacy
- rogers-maryville
- shenandoahpharmacy
- sierracompounding
- smithvillerx
- superiorcompoundingpharmacy
- unioncommunitycare
- vow-tools
- cedenospharmacy
- greystonevillagerx
- cwp-deleon-de67
- expressrxpharmacyllc
- fountainlakefamilypharmacy
- harborpharmacy
- healthpharmacy-usc
- heartlandpharmacy-siloamsprings
- houmafamilydrugs
- lifechangerx
- oceanamedical
- owldrugstore
- palubickispharmacy
- phillydrugstore
- jnrrx
- eaglelakedrugs
- eastmainpharmacy
- medicap-8007
- rosauerspharmacy-42
- u-saveitrx-fortvalley
- bloominggrovepharmacy
- scheurerfamilyrx-caseville
- texasroadpharmacy-applegarth
- valleydrug-chewelah
- lumistryuat
- bonhamfamilydrug
- bellin-health-pharmacy-ashwaubenon
- buffaloprescriptionshop
- carawaypharmacy
- colonialdrugs
- columbiacompounding
- costalfamilyhealth-wiggins
- davisdrugs
- hancockpharmacy-iii
- heb-4points
- knightspharmacy
- mainpharmacy
- maxwellpharmacyinc
- neighborcare-marrero
- nucara-pleasanthill
- physiciansbuildingpharmacy
- pinebrookrx-2
- sadlerhughes
- stedmandrug
- sumralldrugstore
- travs-u-saverx
- ublypharmacy
- wamegodrug
- carmichaeldrugs-monroe
- coastalpharmacyandwellness
- fax.dev.ondoapis
- florenceinfusionservices-vitalcare
- gaughnsdrugstore
- hawks-prairie-pharmacy
- marketplacerx-2583
- medicalartsrx-lawrence
- medicineshoppe-bellevue
- multnomah-fernhill
- northhillrx
- springboropharmacy
- tolsondrug
- townandcountryrx
- willowcreekpharmacy
- avitapharmacy-melville
- cannonrx-kannapolissouth
- klingensmithsdrugstores-newbethlehem
- sempertsdrug
- standardrx-quarryst
- summitpark
- terrysrx-jacksboro
- artcitypharmacy
- bodedruginc-moundcity
- community-first-pharmacy
- eastgatepharmacy
- frederickcommunitypharmacy
- garfieldlowcostrx
- goldenvalleyhealth
- healthfirst-wakeforest
- humepharmacy
- nucara-marshalltown
- stockmensdrug
- syracuseu-savepharmacy
- vowpuppet
- warringtonwellnessrx
- southernstarrx-003
- boydspharmacy-medford
- cornerstone-chenal
- edwardspharmacy
- expressrx-pinebluff
- molterpharmacy
- multnomah-northeast
- multnomah-southeast
- therobbinspharmacy
- toddsrx-elizabethcity
- wylietestbox
- bearlakedrug
- boydmedicinestore
- curtis-claysville
- elyrialowcostpharmacy
- fawcettspharmacy
- lakepharmacy-hiddenvalleylake
- murphyssav-morpharmacy
- nationsmedicines-burlewblvd
- santafepharmacy
- sypharmacy
- techeactionclinicrx-franklin
- thebowmandrugcompany
- avitapharmacy-tulane
- buyritedrugs-ozark
- colbypharmacy
- corporatepharmacyservice
- landys-pharmacy
- marshallmedicineshoppe
- moose-midland
- muniz-riogrande
- oquirrhmountainpharmacy
- rogers-stjoseph
- rtws
- u-saveitrx-dawsonroad
- digital-anchorpharmacyandmedicalsupplies
- albrechtspharmacy
- cornerstoneapothecary-belleplaine
- eldoradotruecarepharmacy
- familydrugmart-sumrall
- gatesrx-mtairy
- hesstonpharmacy
- jonesdrugstore
- mccracken-waynesburg
- medonepharmacy-middletown
- pattersondailyhealthcarerx
- pharmacyvalue
- proxsysrx-corporate
- willowcreekhealthmart
- southlakedrug
- asantepharmacy
- assuremed
- bellespharmacy
- fax-test-1.ondoapis
- josefs-raleigh
- marrasdrugstore
- mowrymedicalpharmacy
- my.dev
- reedspharmacy3
- seminolecommunityrx
- thegalaxydrugstore
- vitalcare-grandrapids
- whittierhealthrx-2
- wilsonssavmor
- andersonapothecary
- cooperspharmacy
- hollandpharmacy
- indydrugco-blairsville
- mariettadiscountrx
- martinsquickmeds
- montanaapothecaryandco
- penlarpharmacy
- sav-morpharmacy-pana
- shavanopharmacy
- taylorpharmacy
- ahf-demo
- alexanderpharmacy
- bourbontownpharmacy
- cashwiserx-3009
- cornerdrugstore-wahpeton
- crcarerx
- expressrx-hamilton
- johnsonfamilypharmacy
- med-mart-lexington
- paylessdrugs-morris
- peoplescustomrx
- roanmountainpharmacy-bakersville
- rosauerspharmacy-36
- savannahfamilypharmacy
- thedrugstore-ironmountain
- tishomingoexpressrx
- tri-areacommunity-ferrum
- vytosrx-hohmanave
- angierfamilypharmacy
- avitapharmacy-decatur
- bennettpharmacyinc
- cantnersdrugstore
- citydrugs-vanalstyne
- dillonfamilypharmacy
- eldahmywellnessrx
- familycare-rockhill
- harveydrugabilene
- iversoncornerdrug
- lakecarmelpharmacy
- moseslake
- neinpharmacy
- qe-ivr
- rockvalleycompoundingpharmacy
- silverpharmacy
- simivalleyltc
- vowuniversity9
- wallsltc
- tradewindspharmacy
- advancedrx-richardson
- atozpharmacy
- bandysrx-salem
- bellpharmacy
- bjrxpharmacyltc
- calhoundrugco
- collegehometownpharmacy
- eaglepharmaoutsourcing
- hazelgreenpharmacy
- hendersonpharmacy
- johnspharmacy-highlands
- solutionsrx
- sunlifepharmacy-sanmanuel
- apexpharmacyandhomecare
- familyrx-southwilliamson
- hcapharmacy
- rosauerspharmacy-7
- palmcare-nationalcity
- broadcreekpharmacy
- edendrug
- extonpharmacyatmarchwood
- group1
- hayatrx-9
- integrityrx-tomsriver
- kubatrx-warehouse
- mainstreetapothecary
- marionpharmacyinc
- northwestcompounding
- nucara-cokato
- rooseveltcitypharmacy
- teamsterscarerx-charlestown
- thepharmacyatthemedicalcenter
- bennettspharmacy
- digital-decaturdrugs
- gerouldsrx-1
- hayatrx-18
- hinesvillerx
- macsrx-powell
- martinspharmacyofruralretreat
- peachrxpharmacy
- sav-morpharmacy-tuscola
- swantonrexall
- transithillpharmacy
- u-saveitrx-centerville
- vashonpharmacy
- walldrugofpamplico
- citydrug-paragould
- dequeenhealthandwellness
- grueneroadrx-hv
- madisonpharmacy
- mitchellsdrugstore-boulevard
- mortonalwanpharmacy
- narayanpharmacy3
- ortizpharmacy
- parkridgepharmacy
- pembertonpharmacy-stmichaels
- sirenpharmacy
- spindaledrug
- standardrx
- thepharmacyatrush
- wellness1rx-mason
- westsidepharmacyandgifts
- avalonprofessionalpharmacy
- bestvaluehometown
- cherokeehealth-lenoircity
- christians-pharmacy-ga
- cobornsrx-2016
- crxpharmacy
- demo
- gordonspharmacyandgifts
- newcityrx
- pineknollrx
- realodrugs7
- timberridgepharmacy
- unitedhealthcenters-sanjoaquinvalley
- villagewalkpharmacy
- vow13test
- nicholsonssumnerpharmacy
- 986pharmacy
- 986pharmacy-8021
- cobornsrx-2029
- duncanspharmacyinc
- grannickspharmacy
- minneolapharmacy
- realo-store17
- sycamorehillspharmacy
- curativemedicine
- u-saveitrx-cairo
- auburnpharmacy-paola
- careconnectpharmacy
- cookfamilyhealthcenter
- costwisepharmacy
- einsteinlivewellpharmacy
- fiverivershealthcenterspharmacy-xenia
- hellscanyonpharmacy
- lakesidepharmacyandmedicalequipment
- lyonsrx
- mcleodchoicepharmacy-seacoast
- medicinestop
- midtownrx
- msuhealthcarepharmacy
- newclintonny
- newgrahampharmacy
- peoplespharmacy
- perronepharmacy
- tietonvillagedrugs
- lenspharmacy
- cherryclinicandpharmacy
- crawford-breazeale-rx
- gerouldsrx-4
- harrisdrug
- jackspharmacy
- jandjdrugs
- lovesrxandgifts-passchristian
- palestinefamilypharmacy
- torresfamilypharmacy-elsa
- aplusfamilyhealthcare-brownsville
- auburnpharmacy-nevada
- claiborne-rx-homer
- hawthorne-pelion
- kellyspharmacy2
- linkpharmacy-la
- notchpharmacy
- realo-specialtycare
- redcliffsfamilypharmacy
- sanjuandrug
- taylorsvilledrugs
- thriftywaypharmacy
- daviscompoundingsolutions
- familyhealthcenter-stmatthews
- oaklanddrugs
- randjdrugs
- 15thstpharmacy
- carlisle-pharmacy
- clinic-hopemill
- doanesvalleypharmacy
- eastoverdrug
- greenleaf
- hayes-barton-pharmacy
- heikepharmacy
- kleins-kom-kmw
- peoplesrx-4
- prescriptioncentreandsurgicals
- servicedrugpharmacy
- southernpharmacy-statesboro
- sparkmanhealthmartpharmacy
- parkwoodpharmacy
- kbpharmacy
- expressrx-taylorsville
- yourcommunitydiscountpharmacy
- hayatrx-6
- hmcpharmacy
- medicineshoppe-1569
- unitedpharmacyofyukon
- cwp-birdrdhospice-3b86
- lloyedcentralcompoundingrx
- mixmedcompoundingpharmacy
- stuckifamilypharmacy
- totalcarepharmacy
- yorkvillerx
- pharmacyplusandsurgical-paterson
- chapinrx
- familydrugmart-poplarville
- familyhealthpharmacy-greenville
- greenhillpharmacy4
- philsdiscount-laporte
- usavepharmacy-hays
- super1pharmacy-30
- yourpharmacyoflexington
- avitapharmacy-austin4
- bataviacommunitypharmacy
- buenavistafamilypharmacy
- corerelief
- courtyardpharmacy
- kimspharmacy
- lifecarerx
- pineridgerx
- prosperitypharmacy-manassas
- sixthavenuepharmacy
- thomasdrugsinc-newyork
- vitalcareofnorthernvirginia
- bestvalueridgleadrug
- davenportpharmacy
- highlandpharmacy
- hometown-lawrenceburg
- integrityrx-williamsport
- randolphmedicalrx
- rockvillerx
- salinasrx-sanbenito
- synergiscompoundingpharmacy
- taborcitymedicinemart
- thecompoundinglab-johnsoncity
- valuerx-warsaw
- vitalcare-southdallas
- dev-api
- tracktownpharmacy
- healingspringspharmacy
- seniorlifepharmacysales
- citydrugstoreofhenderson
- 360medicalcare
- chetjohnsondrugs
- conciergerx
- dcapharmacy
- farmaciareyes-sanalfonso
- kratzershometownrx-wilmington
- louisvillecompoundingpharmacy
- marionfamilypharmacy
- med-a-savepharmacy
- millbrookpharmacy
- newagepharmacy
- owenslongtermcare
- rigginspharmacy
- spartandrug
- santeintegrativepharmacy
- cobornsrx-2028
- jeffersondrugs
- chaneyspharmacy
- childrenspharmacyservices
- dixie-elizabethtown
- eastendpharmacy
- foxdruginc
- halldrugco
- ipackpharmacy
- perkinsdrugs
- rootstown-community-rx
- scriptlifepharmacy
- stbethlehemdrugs
- vitalcareoffrisco
- citizenprofessionalpharmacy
- murraysdrug-heppner
- auburnpharmacy-parkville
- bentleypharmacy
- cobornsrx-2100
- familycarepharmacy-totowa
- hocks-tippcity
- kelley-ross-union
- mountidapharmacy
- rosebankpharmacy
- sinksrx-rolla
- townandcountrydrug
- auburnpharmacy-baldwin
- bestbuydrugs
- bouldercreekrx
- centralpharmacy-batonrouge
- gknrx
- hancockpharmacy-ii
- kjspharmacy
- prairiehillsrx
- realodrugs-lillington
- ritzvilledrugcompany
- rolladruginc
- vowuniversity11
- cornerdrug-woodland
- downingtownmedshoppe
- expressmedpharmacy-dededo
- huntsilverlakedrug
- jayspharmacy
- mountainsidecompounding
- newerapharmacy
- personalized-rx
- smartpharmacy
- thewellnesscenterpharmacy
- grangerpharmacy
- homer
- americanpharmacy
- ashcraftpharmacy
- innercarepharmacy
- jordanpharmacy-graham
- mathespharmacy-2
- parklandrx-desloge
- realodrugs-wilson
- shadycovepharmacy
- sojofamilyrx
- tarrytownpharmacy
- westholtpharmacy
- oaklandpharmacy
- 4urx
- cfh-gulfport
- cooperativehealthpharmacy
- pricechopperpharmacy-7
- realodrugs-hampstead
- reusspharmacy
- shorewoodspecialty
- themcgrathpharmacy
- u-savepharmacy-wayne
- fiverivershc-xenia
- avitapharmacy-satx-1074
- belmartownpharmacy
- hometown-chillicothe
- keystonecarepharmacy
- northfloridarxofchiefland
- richlandhealthrx
- smyrnacompoundingpharmacy
- u-saveitrx-smithsstation
- vcarepharmacy
- fitchburgfamilypharmacy
- guysmedicalcenterrx-mccomb
- hagermanrx
- illinihealthservices
- medmetricsrx
- techedrugs-lafayette
- windhamnorth
- economypharmacy-corporateoffice
- clinicapharmacy-brawley
- riggsdrug
- abopharmacy-brooklyn
- burryspharmacy
- ciolinodrugs
- cwp-beachblvd-1b15
- guysolebrookpharmacy
- marraspharmacy
- masonfamily
- quinlanspharmacy-montourfalls
- boltonspharmacy
- cobornsrx-2006
- danvillepharmacy
- lehanhealthmart
- medicap-8422
- regionalessentialrx
- test-hb
- middleman
- springparkpharmacy
- coastalfamilyhealth-mosspoint
- kauppharmacy-minster
- lakerdrug
- louisburgfamilypharmacy
- sinksrx-south
- southerndrugcompany
- yourcornerdrugstore
- avitapharmacy-beaumont
- broadstreetpharmacy-chesaning
- careprocompounding
- expressdrugssavannah
- familypharmacycare
- glennsapothecary
- hydedrugstore
- langleydrug
- northernbedfordpharmacy
- perfectionrx
- realo-pinkhill
- stapleypharmacy-dinocrossing
- watertownhometownpharmacy
- cherryclinic-medicalcenter
- achorfamilyrx
- apexpharmacy
- applediscountdrugs
- blountdiscountpharmacy-gillst
- brookdalerx
- cannonpharmacy
- cobornsrx-2042
- curemedpharmacy
- develop-sandbox-two
- djdrugs
- eastportfamilypharmacy
- heartcitydrug
- huntingtonmedicineshoppe
- mccoyspharmacy
- newamsterdamdrugmart
- preferredrx-houston
- rosauerspharmacy-44
- avitapharmacy-la-1002
- bayviewpharmacyinc
- medicalhomepharmacy-northolden
- middlesexrx
- morrisstationpharmacy
- paulspharmacy
- stlouishillsrx
- avitapharmacy-warrendale
- burkesmainstreetpharmacy
- cartersfamilypharmacy
- mainline-rx-cresson
- mosscompoundingpharmacy
- whitehorsepharmacy
- capitolheightspharmacy
- centrumspecialtypharmacy
- crownpharmacy
- csuhealthnetworkpharmacy
- currypharmacy-slaughter
- omnifamilyhealth-newshafter
- sandjpharmacy-krum
- saverexpresspharmacy
- obrienpharmacy
- prescriptionservicesinc
- boswellprescriptioncenter
- kaup-fortrecovery
- tamarackpharmacy-rathdrum
- buckleysdrugstore
- cashwiserx-1806
- clarksbigcountryrx-abilene
- galaxypharmacy
- heddenspharmacy
- ourhomepharmacyatmedicalarts
- parkavenuepharmacy
- pharmaxpharmacy-leadington
- shamrockspecialtyrx
- spitaledrugs
- thompsonscommunityrx
- valumedpharmacy-midwestcity
- laboticapharmacy
- towndrugsandsurgical
- waynepharmacy
- bellevuedrugcompany
- careonepharmacy-pennsylvaniaave
- fowlervillepharmacy
- kayceeltcrx
- lakeviewpharmacy
- omnifamilyhealth-wasco
- onealsdrug-plymouth
- rosauerspharmacy-29
- sheltonpharmacy
- tionestapharmacy
- savemoredrugs
- medonepharmacy-emmitsburg
- tjpharmacy
- auburnpharmacy-lamar
- berrydrugofdardanelle
- cannonenhancedcare
- cashwiserx-3013
- lakesidespecialty
- r-excellenceprogram-man
- rams-pharmacy2
- sagharborpharmacy
- southrobesonmedicalcenter
- watsonrxsolutions
- westhavenpharmacy
- auburnpharmacyandcompounding
- evolutionprimarycare
- riversidepharmacy-gilbert
- baggettrx
- downtowndrug
- medicineshoppe-1348
- presidentialpharmacy
- procompounding-1
- towncrestpharmacy
- comfortpharmacy
- pharmacyplus-harrison
- pikevillemedicalcenter
- seashoredrug
- vow
- auroraprofessionalrx
- civiccenterpharmacy
- cornerstone-jfk
- harrishealthmart
- lensdrug
- marshallpharmacy-bcc
- mcalesterexpresspharmacy
- oldtimedrugs
- pharmacyspecialistsofcentralfl
- u-saveitrx-northwest
- uptownpharmacyinc
- economydrug-eureka
- klingensmithsdrugstores-numine
- aandocompounding
- blackoakhomemedical
- develop-sandbox
- deweypharmacy
- forwardpharmacy-deerfield
- lesliesdrugstore
- lionpharmacy
- martinspharmacyofdublin
- purehealthpharmacyllc
- rogers-tarkio
- silverstagepharmacy
- simply-purerx
- valucarecenterhealthmart
- whitewrightpharmacy
- add-drug
- brooklynpharmacy
- citydrug-evanston
- donlonpharmacy
- fallsriverrx
- medicineshoppe-1868
- prescriptiondrugstore-hayti
- qhrpharmacy-eastrussell
- vitalcare-columbia
- winterparkdrugs
- avitapharmacy-brea
- eldondrug
- murraysdrug-boardman
- avitapharmacy-austin3
- burtspharmacydirect-thousandoaks
- cranberrywoodstownhomes
- cwp-ipsec-alma9-test
- dogwoodpharmacy-tifton
- neighborhoodpharmacy
- neugardpharmacy
- penningtonapothecary
- pharmacysolutions-lincoln
- rangelypharmacy
- villageprescription
- wenatcheeclinic
- walkerpharmacy
- capitolhillpharmacy
- communityclinicalrx
- evansdrugs-osceola
- gulfcoastinfusion
- hawthorne-sunset
- healthcarepartnerspharmacy-johnsonville
- linospharmacy-1
- northportdrug
- thepharmacyshopnew
- theprescriptionpad
- henryettadrug
- innovarx
- iukadiscountdrugs
- lakeviewltcpharmacy
- ordwayhealthmart
- southparkpharmacy
- starcarepharmacy
- tinrx
- westcolumbiacooprx
- ultracarepharmacy-newbrunswick
- api.beta
- linkpharmacy-lakeforest
- upperlevisaclinicrx
- applebysdrugstore
- clintondrugco
- cornerdrug-winnemucca
- cpn-uat
- doctorspharmacy
- hazlecompoundingpharmacy
- langespharmacy
- medrx
- moorescompoundingpharmacy
- paylessdrugs-besseme
- phillipshealthmartpharmacy
- pittsborodiscountdrug
- southernstarrx-004
- surecarediscountpharmacy
- ballgroundpharmacy
- basingerspharmacyinc
- bryanpharmacy-enterprise
- cannonrx-kannapolisnorth
- familydrug-shelbyville
- hopehealthpharmacy-irby
- kamailio-sfo1
- losalamitospharmacy
- macsrx-oakridge
- modocfamilypharmacy
- multnomah-eastcounty
- plentywoodrexalldrug
- prairiepharmacy
- riverwoodaitkinrx
- valuerxpharmacy-richlands
- brownspharmacy
- hayatrx-14
- hospitaldiscountrx-west
- albuquerquecitydrug
- hawthorne-aiken
- jeffreysdrugstore
- leoscatalinadrugstore
- mh-gulfport
- oldmainpharmacy
- scotlandhealthcenterpharmacy
- stuckeypharmacy
- tullymedicalclinicrx
- apothecarepharmacyiv-vinegrove
- bonofamilypharmacy
- bryandrugs-hospitaldr
- colquittpharmacy
- expressrx-nationalpark
- johnsrx-farmington
- jonescountydrugs
- kingspharmacy
- medicap-8052
- melbranpharmacy
- moose-concord
- nucara-traer
- qualitypharmacy
- shriverspharmacy-mcconnelsville
- stamfordcommunitypharmacy
- stinesapothecary
- uptowndruggoldenvalley
- keystonepharmacy-grandrapids
- medi-quikpharmacy-booneville
- randdpharmacy
- bestvalueronspharmacy
- canalpharmacy
- islanddrugandwellness
- makerscompoundingpharmacy
- specialtyrx-cullman
- adamsdiscountpharmacy
- carolinapharmacy-seagrove
- dowddrug
- highlandparkpharmacy
- medicine-shoppe-artesia
- rockcreekrx-coalmont
- soldotnaprofessionalpharmacy
- somcpharmacy-wheelersburg
- themooredrugstore
- warddrugstore
- westcoastrxpharmacy-ventura
- drugmartpharmacy
- carepointpharmacy
- camdenvillagerx
- elixrx
- frjpharmacy
- gladwynepharmacy
- medsave-legends
- primecarerx
- realodrugs22
- shelbyvillepharmacy
- southdixiepharmacy
- thefamilypractice
- valleywellness
- vitalcare-lubbock
- woodriverpharmacy
- 77pharmacyinc
- checotahpharmacy
- cheekandscott
- clayspharmacy
- curexa
- cwp-westkendall-eb47
- desertpharmacy
- drugfarmpharmacy
- hurricanefamilyrx
- lewisvilledrug
- lumistry
- mayodanrx
- medicap-8011
- mickeyfine
- nucarepharmacy
- nyespharmacy
- professional-rx-pennsburg
- rosauerspharmacy-14
- snowhillpharmacy
- sysadmin
- trianglecompoundingpharmacy
- valumarketrx-louisville
- vitalcare-oklahomacity
- blairpharmacy-fairfield
- cartersatstonebridge
- crossvillediscountdrugs
- gloyerspharmacy
- goodrichpharmacy-stfrancis
- locustforkpharmacy
- medicinecenterrx-canton
- peacerx
- plaqueminespharmacy
- restorerx
- southcarepharm
- vitalcareofmorristown
- familyrx-aiken
- firstcare-salecreek
- fordpharmacy
- gooddayrx-wellington
- hocks-charleston
- iridiumpharmacy
- pharma1
- rosauerspharmacy-40
- stansdrug
- stclairmedicineshoppe
- urbandalemedicaprx
- bushyrunrx
- hurleydrugs
- southrivercompoundingrx-southside
- uniondrug-va
- saenzmedicalpharmacy-penitas
- auburnpharmacy-abilene
- avitapharmacy-abilene
- bypassrx4
- careplusrxpharmacy
- keesevillepharmacy
- medicalcenterrx
- sunshinepharmacy
- terrysrx-lafollette
- theprescriptionshoppe-albany
- 15rxpharmacy-2
- hopehealthpharmacy-greeleyville
- macsrx-knoxville
- sinksrx-countrymart
- actonpharmacy
- avitapharmacy-neworleans
- bonamipharmacy
- cottonwooddrugs
- dixie-louisville
- eddystonecommunitypharmacy
- hazeltonpharmacy
- hometown-winchester
- sullivanpharmacy-ar
- sunraydrugs
- communitypharmacyofsaccity
- ariespharmacy
- communitymedicinepharmacy-chester
- franksrx
- grapevinedrugrx
- hopehealthpharmacy-orangeburg
- milfordrxandhomecare
- pharmaxpharmacy-imperial
- reddishpharmacy
- reedspharmacy4-martinsburg
- specialtycarerx
- adamsdrugstore
- alaskafamilypharmacy-noblestoffice
- beaverfallshealthmartpharmacy
- bluewellsfamilypharmacy
- louiesfamilypharmacy
- medi-quikpharmacy-ozark
- nationsmedicines-carterrd
- realodrugs-clayton
- rosauerspharmacy-37
- solontowncrestpharmacy
- pennlaurelpharmacy
- acemedical
- adeepharmacy
- centralpharmacy
- chancydrugs-hahira
- cheneyrx
- conwayoutpatientrx
- economydrug-pikeville
- economydrugs-sweethome
- farmerspharmacymarket
- fiveriverspharmacy
- hbpharmacy
- heritagechemistspharmacy
- newpharmacy-yuccavalley
- qrcpharmacy
- rxcompletellc
- servicedrugs-retail
- shegerpharmacy
- sykespharmacy-columbiafalls
- newportcoastpharmacy
- advancecommunityhealth-raleigh
- sav-morpharmacy-louisville
- btaxpros
- chesapeakerx
- dchsretailpharmacy
- familyrx-enid-2
- health-carepharmacy-morrilton
- mabrys-drug
- mainline-rx-blairsville
- woodruffhealthmart
- fortwilliamspharmacy
- advanceddesign
- arenadistrictpharmacy
- avitapharmacy-montgomery
- bandwpharmacy
- davisislandspharmacy
- elmorerx
- fredspharmacy
- greenhillrx
- integratedhealthcarerx1-cop
- lehighpharmacy
- lowellspharmacyartesia
- myersdrug
- somcpharmacy-vanceburg
- southwestrx
- cashwiserx-1801
- etownpharmacy
- gatewaypharmacy
- gunnisonfamilypharmacy
- morganrx-batesburg
- northmainrx
- oakridgepharmacy-tn
- russospharmacy
- waimanalohealthcenterrx
- accesshealthpharmacy-daniels
- ar-expharmacy
- avitapharmacy-satx-1077
- josefs-durham
- nationalspecialtypharmacy
- northrockpharmacy
- stvincentdepaul
- veterinarypharmaceuticalsolutions
- jose
- gilespharmacy
- thedrugstore-haskell
- broadwaypharmacy
- lakegregorypharmacy
- lascassasdrugs
- macespharmacy-philippi
- mtcristopharmacy
- newhopepharmacy
- nicoletpharmacy
- panoramapharmacy
- professionalrx-greer
- summersrx-slater
- themedicinestore-tonganoxie
- dunesfamilyrx
- adamsdrugs-millbrook
- carolinarx-hampton
- dokimosnevadacityrx
- eastendexpress
- heartland-conway
- heritagepharmacy
- valleypharmacy-loveland
- valuespecialtypharmacy
- yourdrugstorerx
- jerseycitypharmacy
- avitapharmacy-eaglepass
- bridgeportpharmacy
- delta-charleston
- familyrx-southaiken
- fleetwoodpharmacy
- joespharmacy-al
- pershingpharmacy
- thecliniconsixth
- avitapharmacy-1082-harlingen
- chapmanrx
- dunnellonpharmacy
- jacksondrugs-alexandercity
- koshlandpharmacy
- leroypharmacyii
- medinafamilypharmacy
- neumanndrug
- newtongrovedrug
- northstaterx
- stvincentspharmacy-east
- tlcpharmacy
- vanmolllc
- wiserx
- marmadukepharmacy
- cwp-hypoluxo-f514
- avitapharmacy-rockhill
- churchsquarepharmacy
- clinicrx-guymon
- islandrx
- lawtoncommunityhealthcenter
- mtvernonpharmacy-fallsway
- cobornsrx-2019
- commonwealthrx-chatham
- communityhealthcare-puyallup
- eldahmywellnessrx-chulavista
- jadfamilypharmacy
- kemperdrug
- mesillavalleypharmacy
- midtownmedicenterrx
- putvindrugstore
- tandcflynnspharmacyinc
- theprescriptionparlour-1
- township-pharmacy
- villagepharmacyofsyosset
- group3
- battlefieldpharmacy
- bestvalue-glenrose
- dokimoseastmainrx
- lifecarelibertydrugs
- lovespharmacyofdiamondhead
- morganrx-gilbert
- nashvillefamilypharmacy
- powellsbloomfieldpharmacy
- powhatandrug
- professionalrx-jasper
- queenspricechopperrx-4
- smithdrug1
- straubmedicalcenteroutpatientrx
- u-saveitrx-corporate
- vhspharmacyatharborsedge
- yrekapharmacy
- armucheepharmacy
- cobornsrx-2048
- kashandkarry
- pattersonfamilyapothecary
- wyomingpharmacy
- gooddaypharmacycorporate
- adamsdrugs-east
- bypassrx-chapmanville
- expressrx-sherwood
- medicalcenterpharmacy-savannah
- medicenterpharmacy-loganprimary
- modnurxincpharmacy
- sav-ritepharmacyeast
- sumnerpharmacy
- timespharmacy-royalkunia
- townandcountryrx-maplewood
- huttonpharmacy
- futrellpharmacy-richsquare
- rosecarepharmacy
- thelaitrampharmacy
- bellewoodpharmacy
- crescentpharmacy
- eldoradomedicineshoppe
- fishersvillefamilypharmacy
- heartofflorida-main
- juniperpharmacy
- medicalartspharmacy-sanleandro
- moose-mtpleasant
- rockdrugstore
- vitalis-pharmacy
- yourgordonsvillerx
- cobornsrx-2017
- blackrockpharmacy
- candcdrugs
- crestlinepharmacy
- driscollhealthpharmacy
- easttennessee-lenoircity
- familypharmacynaples
- heightsspecialtypharmacy
- internationaldrugs
- knkpharmacy
- medonepharmacy-mountairy
- naranjahealthcenter
- patricksquarerx
- princetonpharmacy
- rosespharmacy
- springfielddrugstore
- vineyardscripts
- avitapharmacy-covina
- byhaliadrug
- cabrinipharmacy
- choicespecialtyrx-sugarland
- delmarvapharmacy
- elixirxapothecary
- expressrx-winnfield
- forwardpharmacy-columbus
- gibsondiscountpharmacy
- klingensmithsdrugstores-fordcity
- kubatrx-center
- mtprospectpharmacy
- phar-morerx
- qualityhomehealthcare
- thedrugstoreoneastside
- thepillbox
- u-saveitrx-macon
- wendellpharmacy
- appledrugs-crownheights
- edspharmacy
- globepharmacy
- gooddayrx
- hayatrx-2
- hometownrxpeculiar
- jodisrx
- kearneyparkpharmacy
- limestonepharmacy
- medicap-panora
- syracusecommunityhealthpharmacy
- test-ee
- americanhealthsolutions
- boatwrightpharmacy
- chapelstreetpharmacy
- communityhealth-pasadena
- davisondrugandstationery
- erniespharmacyandwellness
- expressrx-lewisburg
- galesvillepharmacy
- hocks-vandalia
- ilwacopharmacy
- paramorespharmacy
- redlodgedrug
- smc-ca
- thecommunitypharmacy-turbeville
- townpharmacy-sacramento
- health-waysave-ondrugs
- mathespharmacy
- rankosstadiumpharmacy
- timspharmacy
- avitapharmacy-attleboro
- benzerpharmacy
- carmichaeldrugs-covington
- coastalfamilyhealth-baystlouis
- cwp-rainbow-1b51
- deltadrug-portsulpher
- expressrxpharmacy-llc
- hoperx
- mainsourcepharmacy
- moosepharmacy-salisbury
- rapharx
- wakeforestdrug
- markspharmacy-waynesville
- avitapharmacy-mcallen
- bluegrassdrug-campbellsburg
- brokenarrowfamilydrug
- itccompounding
- jessica-test
- lititzapothecary
- pharmetriclaboratory
- thorsbydrugs
- trummdrug-glenwood
- alaskafamilypharmacy-northpoleoffice
- betterlifepharmacy-newbrunswick
- bufordroadpharmacy
- familycarediscountrx-orlando
- harryspharmacy
- hometown-kermit
- jdrugs
- lapalcodrugs
- lifewellpharmacy
- lodipharmacy
- npsltcpharmacy
- phillipsburgpharmacy
- riverpointpharmacy
- sav-morpharmacy-atwood
- snitemanpharmacy
- hamiltonpharmacy
- aldridgesfamilypharmacy
- aniceapothecary
- api.dev
- beaconprescriptions-newbritain
- chrispharmacy-portvincent
- cornerdrug-goldbeach
- expressrx-lakeprovidence
- familyandchildrensservices
- farmaciacentral
- goodbrotherspharmacy
- milexdrug
- pharmaxpharmacy-potosi
- priceharrispharmacy
- quincyrx
- rxxpresshealthmartpharmacy
- scottspharmacy-albany
- springfieldpharmacy
- wilsondrug
- newronsondrug-workerscomp
Current DNS Records
| A | AAAA | MX | TXT | NS | SOA |
|---|---|---|---|---|---|
| n/a | n/a | n/a | n/a | n/a |
Raw Whois Results for 45.77.127.116
# # ARIN WHOIS data and services are subject to the Terms of Use # available at: https://www.arin.net/resources/registry/whois/tou/ # # If you see inaccuracies in the results, please report at # https://www.arin.net/resources/registry/whois/inaccuracy_reporting/ # # Copyright 1997-2026, American Registry for Internet Numbers, Ltd. # # start NetRange: 45.76.0.0 - 45.77.255.255 CIDR: 45.76.0.0/15 NetName: CONSTANT NetHandle: NET-45-76-0-0-1 Parent: NET45 (NET-45-0-0-0-0) NetType: Direct Allocation OriginAS: Organization: The Constant Company, LLC (CHOOP-1) RegDate: 2015-04-24 Updated: 2022-09-20 Comment: Geofeed https://geofeed.constant.com/ Ref: https://rdap.arin.net/registry/ip/45.76.0.0 OrgName: The Constant Company, LLC OrgId: CHOOP-1 Address: 319 Clematis St. Suite 900 City: West Palm Beach StateProv: FL PostalCode: 33401 Country: US RegDate: 2006-10-03 Updated: 2026-06-12 Comment: https://www.constant.com/ Ref: https://rdap.arin.net/registry/entity/CHOOP-1 OrgAbuseHandle: ABUSE1143-ARIN OrgAbuseName: Abuse Department OrgAbusePhone: +1-973-849-0500 OrgAbuseEmail: [email protected] OrgAbuseRef: https://rdap.arin.net/registry/entity/ABUSE1143-ARIN OrgTechHandle: NETWO1159-ARIN OrgTechName: Network Operations OrgTechPhone: +1-973-849-0500 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/NETWO1159-ARIN OrgNOCHandle: NETWO1159-ARIN OrgNOCName: Network Operations OrgNOCPhone: +1-973-849-0500 OrgNOCEmail: [email protected] OrgNOCRef: https://rdap.arin.net/registry/entity/NETWO1159-ARIN # end # start NetRange: 45.77.126.0 - 45.77.127.255 CIDR: 45.77.126.0/23 NetName: NET-45-77-126-0-23 NetHandle: NET-45-77-126-0-1 Parent: CONSTANT (NET-45-76-0-0-1) NetType: Reassigned OriginAS: Organization: Vultr Holdings, LLC (VHL-60) RegDate: 2017-11-03 Updated: 2017-11-03 Ref: https://rdap.arin.net/registry/ip/45.77.126.0 OrgName: Vultr Holdings, LLC OrgId: VHL-60 Address: 900 N. Alameda St. Address: Suite 200 City: Los Angeles StateProv: CA PostalCode: 90012 Country: US RegDate: 2015-03-05 Updated: 2024-04-04 Ref: https://rdap.arin.net/registry/entity/VHL-60 OrgTechHandle: LYNCH267-ARIN OrgTechName: Lynch, Tomas OrgTechPhone: +1-973-849-0500 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/LYNCH267-ARIN OrgTechHandle: VULTR-ARIN OrgTechName: Vultr Abuse OrgTechPhone: +1-973-849-0500 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/VULTR-ARIN OrgAbuseHandle: VULTR-ARIN OrgAbuseName: Vultr Abuse OrgAbusePhone: +1-973-849-0500 OrgAbuseEmail: [email protected] OrgAbuseRef: https://rdap.arin.net/registry/entity/VULTR-ARIN # end # # ARIN WHOIS data and services are subject to the Terms of Use # available at: https://www.arin.net/resources/registry/whois/tou/ # # If you see inaccuracies in the results, please report at # https://www.arin.net/resources/registry/whois/inaccuracy_reporting/ # # Copyright 1997-2026, American Registry for Internet Numbers, Ltd. #
This page displays the publicly-available WHOIS data for 45.77.127.116, which belongs to an unknown organization.
Recently Reported IPs:
๐ณ๐ฑ
45.148.10.151
๐บ๐ธ
2607:f8b0:400c:c00::129
๐ฐ๐ท
211.254.212.59
๐ณ๐ฑ
45.148.10.157