AbuseIPDB » WHOIS 45.77.127.116

45.77.127.116 IP Address Information

ISP Vultr Holdings, LLC
Usage Type Data Center/Web Hosting/Transit
Hostname horizonpharmacy.talkrxsky.com
Domain Name vultr.com
Country ๐Ÿ‡บ๐Ÿ‡ธ United States of America
City Los Angeles, California

horizonpharmacy.talkrxsky.com

Subdomains

  • adamsdrugs-pinelevel
  • glenwoodmedicap
  • leeandpicklesdrugstore
  • loganhealthpharmacy-clinical
  • medicap-altoona
  • mitchellsdrugstore-downtown
  • newberryexpresspharmacy
  • pittsboropharmacyllc
  • sanatogapharmacy
  • smscpharmacy-shakopee
  • themedicineshoppe-shawneetown
  • thompsonspharmacy-newnan
  • wecarepharmacy-stafford
  • westchesterpharmacy
  • ladner-drugs
  • rvapharmacy
  • cainsdrugstorepharmacy
  • panamarx
  • procarerx
  • quisenberryrx
  • stpeterscommunitypharmacy
  • unioncommunitycare-waterstreet
  • westmoreland-newalbany
  • auburnpharmacy-omc
  • christiansburgrx
  • clintonpharmacy
  • decaturdrugs
  • familydrug-manchester
  • laspalmaspharmacy
  • macspharmacy-southpeter
  • medicineshoppe-1956
  • midmichiganchs-houghtonlake
  • northcolumbuspharmacy
  • thompsondrugsaddlebrook
  • truepharmacydevine
  • villageapothecary
  • currydiscountpharmacy
  • apteekpharmacy
  • eurekapharmacy
  • fivemin-kkv
  • gatecitypharmacy
  • hendersonvillehealthmart
  • hinesstreetpharmacy
  • kaleospharmacy
  • medicarx-bloomfield
  • medicpharmacyservices
  • munseyspharmacy
  • orangeblossomfamilyhealthcenter2
  • parklandrx-greenville
  • tanglewoodpharmacy
  • tidewater
  • valu-ritepharmacy
  • williamsburgpharmacy
  • bellsfamilypharmacy
  • cornerstone-fayetteville
  • coronaspecialtyrx
  • crossroads-whiteville
  • easycarerx
  • globerexalldrug
  • jaguarpharmacy
  • kannonhealth
  • machiasfamilypharmacy
  • mainline-rx-somerset
  • marcromspharmacy
  • mecmopharmacy
  • nassaupharmacyinc
  • picocarerx
  • solutionspharmacy-blacksburg
  • springtownpharmacy
  • tinrx-807
  • vitalcareinfusionservices
  • westerndrug
  • woodmoorpharmacy
  • rockymountainpharmacy-estespark
  • blueearthdrug
  • bristolpharmacy
  • c-cdrugs
  • cashwiserx-3004
  • coliseumparkprofessionalpharmacy
  • curexpharmacy
  • everestpharmacyandmedicalsupply
  • mitchells-pharmacy
  • mobley
  • okiespharmacy
  • orchardsdrug
  • preferredrx-fannin
  • preferredrx-okatie
  • rileys
  • riverviewpharmacy
  • rockcanyonrx
  • scheurerfamilypharmacy-elkton
  • sinksrx-belle
  • summithealthpharmacy
  • windhampharmacy
  • wynnefieldpharmacy
  • yeoldemedicinecenter
  • sugarriverpharmacy
  • economypharmacymuskogeewestside
  • boonescreekpharmacy
  • caredirectrx
  • cowboydrug
  • deluxepharmacy
  • infinitypharmacy-nealst
  • neilscompoundingpharmacy
  • novaqhealth
  • professionalrx-charlotte
  • prontopharmacy4
  • thriftymedpluspharmacy
  • citizenspharmacyservices
  • beardrugsofkittyhawk
  • cwp-miamibeach-f504
  • evansdrugs-lockwood
  • expressmedpharmacy-2
  • friendhealthpharmacy1
  • greenhillpharmacy1
  • jacksonstreetdrug
  • kermitpharmacy
  • mypharmacyandoptical-lexington
  • rams-pharmacy
  • thomastonprescriptionshop
  • alfords-ky
  • completecarepharmacy
  • farmaciaplaza18
  • fortwaynecustomrx
  • haguepharmacy
  • healthsourcepluspharmacy
  • lincolnrx-ferndale
  • manorpharmacy
  • mcdougallsdrugcenter
  • nbpharmacy
  • romanpharmacy
  • sav-morpharmacy-arcola
  • stoneviewpharmacy
  • summersrx-kearney
  • tunicapharmacy
  • dannysrx-oneida
  • bearskinhealthclinicpharmacy
  • charlieshometownpharmacy
  • cherryspharmacy
  • goodrichpharmacy-anoka
  • harmonsdrugstore-robinson
  • hickmanspharmacy
  • lakesidepharmacy-oroville
  • memorialwestoutpatientrx
  • prosserpharmacy
  • ranger
  • save-ritepharmacy-prospect
  • sinksrx-stclair
  • soledadpharmacyandwellness
  • unionpharmacy-newtonville
  • westsidepharmacy
  • drugco-nashville
  • kattermanssandpointpharmacy
  • michaelspharmacy
  • prunellapharmacy
  • ashevilleinfusionservices
  • blountdiscountpharmacy-blounthospital
  • delbartonmedicalpharmacy
  • epitomerx
  • familydrugmart-pearlriver
  • healthparkrx-raleigh
  • hikmapharmacy
  • mainstreetdrug-wilburton
  • nucara-austin
  • omakpharmacy
  • parkwaypharmacy
  • preferredcherokeepharmacy
  • prescriptioncenterpharmacy
  • primishapharmacy
  • rivertonpharmacy
  • save-ritedrugs-radcliff
  • sbpharmacy
  • summersrx-bluesprings
  • volunteerpharmacy
  • rxvip
  • fullertonmedicalpharmacy
  • greenwaypharmacy
  • soundshore-mtvernon
  • tri-areacommunity-laurelfork
  • beebefamilypharmacy
  • carolinamountainpharmacy
  • churchillpharmacy
  • citydrug-nys
  • expressrx-bartlesville
  • familydrug-columbiana
  • heritagepharmacy-kingfisher
  • pattersonkeyrexall-salina
  • penobscotcommunityhealthcare
  • thepickwick-pharmacy
  • candlewooddrugs
  • wellnessrx-compound
  • 4frontpharmacy
  • apothecarepharmacy-elizabethtown
  • avitapharmacy-greenvalley
  • bainbridgepharmacy
  • baptisttowerpharmacy
  • belmontuniversity
  • boydsfamilypharmacy
  • harvestdrugandgift
  • hometownpharmacyofzachary
  • korupharmacy
  • lakewoodpharmacy
  • lonestarcompoundingpharmacy
  • phillipsdrug
  • pruettscutraterx
  • realodrugs-smithfield
  • sav-ritefamilypharmacy
  • shermansapothecarypharmacy
  • sykespharmacy
  • advancedhealthrx
  • cwp-east-postorange
  • durancentralpharmacy
  • hersheycaremennonitevilla
  • preferredrx-vancouver
  • rampharmacy
  • rapidaccesspharmacy
  • relionpharmacy
  • sandrdrug-jasper
  • seeberspharmacy
  • stmarypharmacy-northridge
  • transit-hill-temp
  • watchcitypharmacy
  • linkpharmacycorp
  • adamsdrugs-south
  • akronhealth
  • archerclinicpharmacy
  • bereadrug
  • catoosafamilypharmacy
  • clinicpharmacy-cynthiana
  • dolcrx
  • fredoniapharmacy
  • libertydrugandsurgical
  • sheridanexpresspharmacy
  • siglerrx3
  • sinaipharmacy
  • ucfstudenthealthservices
  • unitedhealthcenterspharmacy
  • villagerx-rockypoint
  • warehousepharmacy
  • zebulondrug
  • westsidehealthmartpharmacy
  • eastlakepharmacy
  • avitapharmacy-fresno
  • cape-hopemills
  • gatewaypharmacy-bismarck
  • hazletpharmacyinc
  • jamesdrugstore
  • pbccpharmacy
  • primaryplusmaysville
  • somcpharmacy-maincampusemployee
  • southbaltimorepharmacy
  • thedrugstore-kernville
  • vitalcareofportland
  • omaktribalhealthcenterpharmacy
  • bakerexpresspharmacy
  • dilworthdrug-charlotte
  • hubspecialtypharmacy
  • jelksfamilyrx
  • kexrxpharmacy-fallscity
  • lccpharmacy
  • officepracticeofpharmacy
  • onealsfamilypractice
  • picayunedrugnorth
  • robertsdrugstore
  • rochelledrug
  • sikestonmedicenterrx
  • spotswoodpharmacy
  • vidorfamilypharmacy
  • wallshealthmart
  • avitapharmacy-charleston
  • doubleoakmountainpharmacy
  • heartland-arkadelphia
  • irwindrug
  • keystonepharmacy
  • loyaltypharmacy
  • multnomah-rockwood
  • oldtownrx-piercecity
  • smithsdrugsofforestcity
  • theowlpharmacy-southway
  • thepharmacyattghs
  • trianglepharmacy-mountaintop
  • vcarepharmacy-chestnuthill
  • walldrug
  • thecornerdrugandwellness
  • kirbyrxonmarket
  • gracecarepharmacy
  • avitapharmacy-houston2
  • blackoakpharmacy
  • cwp-millake-f516
  • laboticarx
  • mastfamilydrug
  • ranchoparkcompoundingpharmacy
  • sigmapharmacy
  • augustahealthprescriptionservices
  • gastonfp
  • medicalplazapharmacy
  • metcarerx
  • ocontofallspharmacy
  • sterlingspecialtypharmacy
  • sweetgrass-carolinapark
  • theblairpharmacy
  • villagedrugco
  • turnagedrugstore
  • altituderxllc
  • avitapharmacy-laredo
  • bodedruginc-vienna
  • caldwelldiscountdrug
  • edsnellspharmacyshop
  • familycarespecialtypharmacy
  • fivepointscooperativephcy
  • gulfbreezeapothecary
  • med-worldpharmacy
  • medicalpharmacy-zachary
  • medtimerx
  • monahanspharmacy
  • mosheimmedicineshoppe
  • rushmorecompounding
  • stilwellpharmacy
  • thriftwayflatbushavedrugcorp
  • univofkansas-bellmaincampus
  • winnwaypharmacy
  • applerx-whittier
  • austincompoundingpharmacy
  • cypresspharmacy
  • essexcarepharmacy
  • familymeds
  • fivemin-callcenter
  • granitepharmacy-missoula
  • maggypharmacy
  • medicinemarketcompoundingpharmacy
  • medicineshoppe-hesperia
  • salinasrx-harlingen
  • sinksrx-iberia
  • somcpharmacy-waverly
  • stuartspharmacy
  • apexpharmacyandhomecarecenter
  • becksdrugs
  • everestpharmacy
  • soulandbodypharmacy
  • avantpharmacy-dallas
  • bloomfielddrugstore
  • greenhillpharmacy5
  • hometown-madras
  • mainstrx-savannah
  • medicineshoppe-pleasanton
  • midcountypharmacy
  • moonsdrugstore
  • omnifamilyhealth-chester
  • rockytoprx
  • sharpsburgrx
  • spencesmedicalcenterrx-lakejackson
  • stanleyrxcompounding
  • thurmanspro-medpharmacy-mountpleasant
  • tri-areacommunityrxatfries
  • vowuniversity5
  • westmontpharmacy
  • yorkhospital-apothecary
  • gooddaycentralfill
  • magnumcompounding
  • browndrug-pittsfield
  • 360infusioncenter
  • ahf-uat
  • betterlifepharmacy-westny
  • boltonhealtmart
  • campbellspharmacy-seagirt
  • cheekandscott-jasper
  • citizenspharmacy
  • cookspharmacy-shavertown
  • corepharmacy
  • frenchspharmacy
  • ncapharmacy-commercetownship
  • panamarx2
  • patelinc
  • r-excellence-man
  • rubyspharmacy
  • syslog
  • watsonville-ca
  • hammerlanerx
  • micromerchant-eprimerx-test
  • oneillfamilypharmacy
  • palacedrugstore
  • theclinicrxpharmacy
  • wynnspharmacy
  • avitapharmacy-la-1001
  • brightonhealthmartpharmacy
  • jordanvalleychc-lebanon
  • oldtownrx-monett
  • rawhidedrug
  • ritecarepharmacy
  • sandersvilledrugco
  • tamarackpharmacy
  • wolfriverpharmacy
  • wyomingdrugs
  • pharmacyhomecare
  • pioneer
  • arnolddrugco
  • digital-betterlifepharmacy-westny
  • hjohnsonpharmacy
  • judysdrugstore
  • nanticoke
  • paramuspharmacy
  • ratonmedicineshoppe
  • rowleypharmacy
  • rxatwellington
  • westoncountypharmacy
  • sellersvillepharmacy
  • adamsdrugs-wetumpka
  • alexapharmacy
  • clarkspharmacyofsaltville
  • crescentcenterdrugs
  • deltadruginc
  • hubbardyoungpharmacy
  • invictuspharmacy-rochellepark
  • luxemedcompoundingpharmacy
  • medicap-8438
  • medstoppharmacyandsurgical
  • pinepharmacy
  • thomaspharmacy
  • blosspharmacy
  • cookevillemedical
  • delrayshorespharmacy
  • downeydruganniston
  • fivemin-kalihi
  • franklinpharmacy
  • lowcountrypharmacy
  • medicinemanpharmacy-valley
  • rosauerspharmacy-26
  • scriptshoppharmacy
  • test-ivr-6
  • totalcarepharmacy-baconton
  • u-saveitrx-palmyra
  • uniteddiscountpharmacy2
  • unionpharmacy-belmont
  • cedarspringspharmacy
  • expressrx-union
  • greatplainspharmacy
  • greenfieldpharmacy
  • hawthorne-camden
  • leescreekpharmacy
  • masspackpharmacyservices
  • orangeblossomfamily-homeless
  • rightwaydrug
  • rileydrugs-geneva
  • starpharmacy
  • truecarerx
  • u-saveitrx-claxtonhobbs
  • u-saveitrx-clayton
  • wardspharmacy
  • allentownpharmacy
  • brighamcommunityrx
  • cobornsrx-2037
  • cornerstonedrug
  • cwp-plaza-linda-cb56
  • cwp-scongress-f517
  • daniels-blackville
  • genscriptsadminoffice
  • highstreetpharmacy
  • ludsrx
  • royalpharmacy-broadway
  • toplinepharmacy
  • apothecarepharmacyv-elizabethtown
  • avitapharmacy-orlando2
  • camdendrug
  • citydrugpharmacyandgifts
  • communityhealthandwellness
  • customprescriptions
  • expressrx-trumann
  • lifetimepharmacy-aubrey
  • littlesilverfamilypharmacy
  • pharmacarefloralarx
  • sagerx
  • victorymedicalcenterrx
  • freedomhillcommunityhealthcenter
  • hometownconnectwest-louisville
  • avitapharmacy-dallas
  • carlsdrugstore
  • colonialvillagepharmacy
  • communityhealthnetrx
  • curtispharmacy-carmichaels
  • greenhealthpharmacy
  • herolds-northcharleston
  • mactpharmacy
  • medi-wisepharmacy
  • medicalpark-rockingham
  • prescriptionstogo-1
  • test-de
  • torresfamilypharmacy-raymondville
  • aftonpharmacy
  • fridayharbordrug
  • hometown-carrollton
  • hometownpharmacy-trinidad
  • imperialbeachpharmacy
  • mandspharmacy
  • rpc2bpharmacy
  • rxmartpharmacy
  • sandbdrugs
  • bandyspharmacy-trenton
  • chinovalleyrx
  • empirepharmacy2-melbourne
  • fairwaysav-mordrugs
  • rxclinic-charlotte
  • thumbbutterx
  • longpointpharmacyrx
  • acaciaapothecaryandwellness
  • avitapharmacy-newyork
  • bellin-health-meds-bellevue
  • bestvaluedrug
  • communitycareclinicofrowan
  • downtowndrug-watertown
  • fastandfriendlyrx
  • hayatrx-15
  • hudsonviewrx
  • jamesandwilkspharmacy
  • kcpharmacy
  • latimerspharmacy
  • mohrmannsdrugstore
  • perkinsrx
  • pratersrx-sarcoxie
  • shawsvillepharmacy
  • sprucemountainrx
  • u-saveitrx-ogallala
  • whitebluffpharmacy
  • boydsdrugrxexpress
  • hawthorne-laurel
  • hometownpharmacy-ravenva
  • keansburgdrugs
  • medicineshoppe-oneida
  • neilspharmacyinc
  • nucara-northbranch
  • riversidepharmacy-yubacity
  • saenzmedicalpharmacy-eastridgerd
  • storyroadpharmacy
  • tigerpharmacy
  • toledopharmacy
  • monumentpharmacy
  • hartzellspharmacyinc
  • avitapharmacy-louisville
  • burnspharmacy
  • cherokeepharmacy
  • expressrx-hebersprings
  • firstcarepharmacy-dayton
  • goodykoontzdrugstoreinc
  • healthmartrx-bennington
  • hillstonepharmacy
  • larkinpharmacy-biscayne-miami
  • martinspharmacyofchristiansburg
  • medicap-8043
  • themedicinecabinet-alexandria
  • thriftdrugs
  • villagepharmacy-bessemer
  • centennialrx-bridesburg
  • innovarx-iv
  • noblesvillelowcostrx
  • pelicandrug
  • pkscompounding
  • realodrugs1
  • sierrablancapharmacy
  • smarthealthpharmacy
  • summitcarepharmacy
  • familyhealthcenterpharmacy-paterson
  • abramsroyalpharmacyii
  • bayoupharmacy
  • blountdiscountpharmacy-west
  • bryanpharmacy-southside
  • burtspharmacy-westlake
  • butlersapothecary
  • customcarecompounding
  • harlesscenterpharmacy
  • horizonhealthpharmacy
  • mtvernonrx-cathedral
  • polemountainrx
  • randmfamilypharmacy
  • stonegatepharmacy
  • testivr2
  • thepillbox-springcreek
  • usmedicalsupply
  • viselspharmacy
  • villageprescriptioncenter
  • adamsdrugs-vaughnrd
  • apothicare360
  • boroparkpharmacy
  • friscopharmacy
  • hugotondrug
  • maidendrugcompany
  • medonepharmacy-boonsboro
  • millershealthmartpharmacy
  • save-ritedrugs-brandenburg
  • thedrugstore-crystalfalls
  • wilsonwil-savpharmacy
  • medicinemart-aiken
  • baldrockpharmacy
  • accokeekdrugandhealthcare
  • centralvalleycommphcy
  • five-min-alamoana
  • jandmdrug-homeland
  • kubatrx-south
  • maplemountain
  • medicorxspecialty
  • pharmacyplus-barry
  • plazapharmacy-thousandoaks
  • twincitypharmacy
  • wheelspharmacy
  • wireguard
  • youfirstpharmacy
  • avitapharmacy-arleta
  • cambriadiscountdrug
  • cornerstonepharmacyjfk
  • delta-hollywood
  • fitzgeraldspharmacy-williamsburg
  • flagpharmacy
  • harbordrug-deckerville
  • liveoakpharmacy
  • medicineshoppe-clovis
  • medicineshoppe-orinda
  • montezumadrugcompany
  • northolmstedlowcostpharmacy
  • oswalds-pharmacy
  • turnersfamilypharmacy
  • ulmerpharmacy
  • wolvesdenpharmacy
  • seminolepharmacy
  • cobornsrx-2032
  • mainline-rx-portage
  • palimomimedicalcenteroutpatientrx
  • pharmacyplus-winchester
  • thefriendlypharmacy
  • thepharmacia-washingtonmill
  • townelakefamilyrx
  • windhamrx
  • wesleysdev-fluent-three
  • buxhealthcare
  • boydsdrugmart-east
  • conwayseastsiderx
  • harveydrug
  • huntersspecialtypharmacy
  • jandjpharmacy
  • lynnspharmacy
  • milwaukeepharmacy-2
  • oakleyhealthmart
  • pharmacyplus-paterson
  • pilgrimpharmacy
  • provisionpharmacy
  • stocktonrx
  • tallmanspharmacy
  • thompsonstownstreetrx
  • u-saveitrx-woodbury
  • villagerx-ellsworth
  • clabaughpharmacy
  • omnifamilyhealth-fresno
  • riverwalkpharmacy
  • avitapharmacy-satx-1076
  • bankspharmacy
  • citizenpotawatomination-east
  • doughertyspharmacy-forestpark
  • kelbelpharmacy
  • metcalfedrugs
  • miguelspharmacy
  • orchardpharmacy
  • poolespharmacy
  • sheldonpharmacyofyale
  • talkrxconversion
  • vitalcareofcollegestation
  • youroakridgepharmacy
  • medicineshoppe-838
  • arcadiafamilypharmacy
  • communityhealthcare-hilltop
  • holleypharmacy
  • lakesiderx
  • martellaspharmacy-windber
  • mountshastapharmacy
  • northfloridapharmacy-oldtown
  • oceanshoresrx
  • owlhomemedical
  • reddoorrx
  • rockpharmacy
  • silvertonpharmacy
  • tomahawkrx
  • avitapharmacy-1071-washington
  • avitapharmacy-wiltonmanors
  • fairmontpharmacy
  • gooddayrx-yuma
  • hometown-beavercreek
  • ipsectest2
  • medicalcenterpharmacy-midland
  • pharmacyplus-passaic
  • rileysrx
  • thunderdrug
  • carrolldrugstore
  • doctorscenterpharmacy
  • harrysrx
  • kinesfamilypharmacy
  • nwmedicationmanagement
  • wellspacehealthrx
  • genscripts-tulsa
  • pennscarefamilypharmacy
  • midwestcompounders
  • vitalcareofirvine
  • buntespharmacy
  • carrollrx-trussville
  • chcoftheblackhills
  • keymedicalcenterpharmacy
  • lafamiliapharmacy
  • landmpharmacy
  • medicap-meridian
  • medicineplus
  • milwaukeepharmacy
  • nucara-westunion
  • pacificcompoundingpharmacy
  • pharmcare-tn
  • saenzmedicalpharmacy-lindberg
  • southendpharmacy
  • villagecompoundingpharmacy
  • drugco-littleton
  • hardingroadpharmacy
  • hendersonvillepharmacy
  • hightidehealthcare
  • hometown-roseburg
  • kanzapharmacy
  • mosersu-saverx
  • nikkis-hometownrx
  • nucarahomemedical-coralville
  • onesourcerx
  • pharmacycare
  • pointepharmacy
  • savcarepharmacy
  • southsidepharmacy
  • tanglewooddrugstore
  • valumarketrx-mtwashington
  • duffeydrug
  • lindsaydrugco
  • medicap-8057
  • pawpawvillage
  • pinnacleapothecary
  • super1pharmacy-35
  • hayatrx-30
  • avalondiscountdrugs
  • purescriptscompoundingpharmacy
  • adamsdrugs-medicineontime
  • annapolisprofessionalrx
  • camascenterclinicpharmacy
  • congressstreetrx
  • creightonuniversitypharmacy
  • eagledrug-winters
  • harrisfamily-tn
  • hironsdrug
  • hometownpharmacy-specialty
  • lifelinecmopharmacy
  • medicappharmacygreenfield
  • mirx
  • noconapharmacy
  • pinebrookrx-3
  • travs-u-saverx-osceola
  • vitalcare-coralsprings
  • alliancecommunityrx
  • contigocompoundingandinfusion
  • dandhdrugstore
  • eltejonpharmacy-frazierpark
  • familyhealthcenterrx-orangeburg
  • hwy69southfamilyrx
  • kirks-hartland
  • knollwoodpharmacy
  • marketplacerx-littlerock
  • medicinemartpharmacy
  • medicineshoppe-1974
  • pomeroypharmacy
  • thepharmacieshoppe
  • tomsfamilypharmacy
  • vitalcareofscranton
  • riesbeckspharmacy-stclairsville
  • wellpackpharmacy
  • alanspharmacyofstillwater
  • cannonrx-concord
  • familycarerxpharmacy
  • greenwoodpharmacy
  • realodrugs3
  • stoneshealthmartpharmacy
  • charlesrivercommunityhealth-2
  • cobornsrx-2023
  • delta-eutawville
  • depietrospharmacy
  • dundeepharmacy
  • humana
  • mobilityplus
  • rickerpharmacy
  • sinksrx-cuba
  • valudrug
  • wellness1rx-kettering
  • westtownepharmacy
  • carsondrug
  • hiersdrugstore
  • henryspharmacyllc
  • lc-familyrx
  • minipharmacy
  • vowuniversity7
  • ihs-jamestown
  • compoundingpharmacyofgreen
  • cornerstone-lakewood
  • harmonsdrugstore-palestine
  • larrysfamilypharmacy
  • medicinestop-i
  • niespharmacyandwellness
  • okmulgeediscountpharmacy
  • omnifamilyhealth-niles
  • potterdrug
  • prestonpharmacy
  • richard-test
  • southloupcommunitypharmacy
  • valeroadpharmacy
  • watkinspharmacy
  • medicineshoppe-jamestown
  • bufordpharmacy
  • addisondiscountpharmacy
  • allsaintspharmacy
  • bridgeportcommunitypharmacy
  • clarx-tennessee
  • dorisisonrx
  • healthheropharmacy-unasource
  • healthyway-cedarknoll
  • kooncedrug
  • lavitacompoundingpharmacy
  • lifecarepharmacyuvalde
  • medicineshoppe-liberty
  • rosauerspharmacy-33
  • towntotalcompoundingcenter
  • woodspringspharmacy
  • brewsterpharmacy
  • cornerdrughealthmart
  • crawforddrug
  • cwp-anderson-1d22
  • evansdrugs-sunrisebeach
  • halfmoonbaypharmacy
  • heartpharmacy
  • petscriptspharmacy
  • romapharmacy
  • summersrx-warrensburg
  • wesvowutils
  • accesshealthpharmacy-mabscott
  • bienestarrx
  • cornerdrug-melbourne
  • healthsmart-claremont
  • keycompoundingpharmacy
  • ralphsthriftwaypharmacy
  • rosvoldpharmacy
  • southeastpharmacy
  • tompkinsvilledrug
  • westendpharmacy-loganville
  • healthpropharmacy
  • villagerx-miami
  • centralohiocompounding
  • basindrugs
  • bellin-health-pharmacy-denmark
  • communitypharmacyofrockwellcity
  • cwp-palmsprings-f515
  • familyhealthcenterpharmacy
  • geringu-savepharmacy
  • hayatrx-7
  • kexrxpharmacy-hiawatha
  • medexpharmacy
  • moserpharmacy
  • proscriptpharmacy-fresno
  • shriverspharmacy-compoundinglab
  • starwoodpharmacy
  • summersrx-boonville
  • tinrx-809
  • villagerx-fayetteville
  • vitalcareofportland-me
  • realohealthplex
  • familyhealthcarecenterrx
  • hayatrx-11
  • hinaspharmacy
  • millingtonpharmacy
  • modnurprescriptionpharmacy
  • pharmpedia
  • pricefamilyrx
  • redspringsoldmainpharmacy
  • savemartpharmacy
  • bozemanchppharmacy
  • clinic-durham
  • cwp-plantcity-1b42
  • familyrx-humbolt
  • lifechangerx2
  • marengopharmacy
  • marinadelraypharmacy
  • simplypharmacy
  • talleylaw
  • tdpharmacy
  • univofkansas-southlakeretailrx
  • utoledoedu-test
  • bayviewsrcpharmacy
  • bigcdrugs-skyline
  • bvdrug
  • crawfordspharmacy
  • wesleystestpharmacy
  • adelaideapothecary
  • custommedicorx
  • mcbainfamilyrx
  • medicap-parma
  • medlifepharmacy
  • mypharmacy-orangeburg
  • omnifamilyhealth-oswell
  • pillboxpharmacy-willard
  • redspharmacy
  • southforkpharmacy
  • ranchopharmacy
  • sunlifepharmacy-florence
  • arundelmillsrx
  • clarksonpharmacy
  • gosnelldrugs
  • lambertdrugstore
  • medcare-clover
  • medi-expharmacy
  • newalbanyrx
  • theprescriptionpad-monticello
  • unionpharmacy-needham
  • waconiaclinic
  • goltzpharmacy
  • kershawfamily
  • pillboxmodesto
  • fop
  • advancedrx-paincare
  • belmontpharmacy
  • cape-girardeau
  • cobornsrx-2007
  • fairfaxpharmacy
  • magnoliadrugcoinc
  • medicinemartpharmacy-rosewooddr
  • nucara-peterson-mtnlake
  • portervillepharmacy1
  • pranacarepharmacy
  • westfieldpharmacy
  • 986specialtypharmacy-2
  • accesspharmacy
  • elkandrug
  • familyrx-hampstead
  • heartofflorida-central
  • irmodrug
  • smithpharmacy
  • unionpharmacy-ma
  • cannonrx-morrocroft
  • comanchecountymemorialhospital
  • elydrugs-glasgow
  • fivemin-nanakuli
  • medchoicepharmacy
  • professionalpharmacy-wichita
  • steinhatcheedrugs
  • sunlifepharmacy-maricopa
  • villagepharmacy-cambridge
  • youngsrx
  • aandbsunsetpharmacy
  • docspharmacy
  • downhomepharmacy
  • equilibria
  • knipperx
  • rinehartclinic-rx
  • walterspharmacy
  • trianglepharmacy-westcolumbia
  • auburnpharmacy-holden
  • avitapharmacy-birmingham
  • cobornsrx-2022
  • farmaciadelpueblo-calexico
  • hankinsondrug
  • manitowocpharmacies
  • mckinneysapothecary
  • medicineshoppe-webbcity
  • milfordstreetpharmacy
  • pharmacy575
  • prospectdrugs
  • rainylakepharmacy
  • rogerspharmacy-dumas
  • theprescriptionshop-calhoun
  • avitapharmacy-sanrafael
  • corleyspharmacy
  • josephpharmacy
  • parkwaydrugs-leland
  • theprescriptionparlour3
  • readyrxpharmacy
  • parkwaydrugs-frenchrd
  • rxexpresspharmacy
  • abcmedcare
  • alumcreekatsandplant
  • bullhookcommunityhealthcenterpharmacy
  • davisdrugcompany
  • mikesrx
  • pharmacarecompounding
  • shriverspharmacy-wellnessiv
  • somersetmedicineshoppe-ky
  • sunlifepharmacy-eloy
  • tinrx-805
  • westminsterfamilydrug
  • acaciaapothecary-2
  • allendrugandvariety
  • asmhomedelivery
  • avitapharmacy-kissimmee
  • genscripts-admin
  • harbordrug-harborbeach
  • healthridgepharmacy
  • northbronxpharmacy
  • starlingpharmacy
  • uptowndrugandgift
  • yorkandcompanypharmacy
  • pangolin
  • centraloklahomafamilyrx-colony
  • customedicapharmacy-northend
  • kempsonrexalldrugs
  • meadowmontpharmacy
  • medcare-bennettsville
  • medleypharmacy-gerald
  • rxexpresspharmacyofeastnorthport
  • sarasotacompoundingpharmacy
  • waterburypharmacy
  • westcoastrxpharmacy-thousandoaks
  • chicopharmacy
  • drugsamericapharmacy
  • familyrx-enid
  • hendersonpharmacyservices
  • lajarahealthmartpharmacy
  • lovelandcommunityhealth
  • nockleyfamilyrx-scranton
  • plainsdrug
  • real-time-web-socket-server
  • scottsborofamilyrx
  • towerdrugspharmacy
  • u-saverx-nw
  • valleywiderxanddme-0419
  • doverfamilyrx
  • cwp-hialeah-1e42
  • damienpharmacy
  • garfieldpharmacy
  • goudeausrx
  • greenpharmacy-bronx
  • medicalcenternorthshorerx
  • medicap-8003
  • moose-monroe
  • owensborofamilypharmacy
  • pharmacyplus-carrollton
  • prescriptionshopmontebello
  • robertjacobsonpharmacy
  • rogersvillerx
  • wes-test
  • ahmarx-elmsford
  • brownsvillefamilypharmacy
  • bypassrx2
  • curleyspharmacy
  • cypresswellnesspharmacy
  • duransrx
  • heartlanddiscountrx
  • knightspharmacy-berea
  • laurelmedicalcenterpharmacy
  • markspharmacy-brysoncity
  • orbypharmacy
  • pharm-a-savegranitefalls
  • towneapothecary
  • westmoreland-sellersburg
  • portability
  • allaymedsinc
  • carescpharmacy
  • craborchardpharmacy
  • famcarepharmacy
  • hollyspringsrx
  • kelley-ross-ltc
  • kleins-kp
  • mainstrx-laurel
  • medicap-cpap
  • mounthorebpharmacy
  • okemahpharmacy
  • pathwaypharmacy
  • vansdeliverypharmacy
  • villagepharmacywakeforest
  • vitalcareoftowson
  • gooddaypharmacy-sprouts
  • bellavistapharmacy
  • cannonrx-sedgefield
  • centercitypharmacy
  • cwp-littlehavana-cb54
  • greenhillpharmacy3
  • hayatrx-21
  • icecast-ny3
  • nhrmc-employeepharm
  • northfieldpharmacy
  • pharmasave-monroe
  • pointemedpharmacy
  • ranchopueblorx
  • redspringshealthcenter
  • saenzmedicalpharmacy-nolana
  • silvercarepharmacy
  • sinksrx-gerald
  • certacarepharmacy
  • carerxpharmacy
  • centermedicationmanagement
  • drugcityrx-baltimore
  • keyesdrug
  • kingsrx-hayesville
  • laconnerdrug-1146
  • lumistrytraining
  • luxemburgpharmacy
  • mrhpembrokeroadrx
  • professionalrx-pottstown
  • ralphspharmacy
  • sbhmedical
  • scheurerfamilyrx-sebewaing
  • schottspharmacy
  • shrivershospice
  • springfieldmedicenterpharmacy
  • tmhspecialty
  • wecarepharmacy
  • whiteforddarlingtonllc
  • carringtondrugs
  • communitycarepharmacy
  • eaglerx
  • healthyurxinc-dubailst
  • medicalcenterpharmacyinc
  • middletownpharmacyandwellness
  • pattersonhealthmart-lincoln
  • pottscamprx
  • vow-utils
  • chapinpharmacy
  • scottcitypharmacy
  • citycenterdrug
  • cwp-westland-cb57
  • groverx-sunshine
  • medi-thriftrx
  • mesapharmacy
  • ourhomerx-auburn
  • precisioncarepharmacy
  • rioricopharmacy
  • rosedrugofdover
  • roselawnpharmacy
  • tlc-medical
  • tomballhealthmartpharmacy
  • villaricadrugs
  • vitalcare-morrestown
  • clarklowcostpharmacy
  • corbychemist
  • groverx
  • hill-city-pharmacy2
  • hometownpharmacy-campbellsville
  • malakoffpharmacy
  • medpointpharmacyllc
  • methodist-northlake
  • randrtaxservices
  • rockymountmedicalpark
  • sinksrx-owensville
  • tricarepharmacy
  • u-saveitrx-byron
  • woodarddrugstore
  • wooripharmacy
  • medicap-gardenvalley
  • bellwooddrugs
  • chancydrugs-valdosta
  • choicepharmacy
  • goldendalepharmacy
  • greenleafpharmacy
  • kleins-kp4
  • medicalcenterpharmacy
  • mitchellscostpluspharmacy
  • training
  • universityrx-universityofpittsburgh
  • wilsavdrugs-madisonville
  • avitapharmacy-lancaster
  • blacksburgpharmacy
  • carispharmacy
  • clermontpharmacy
  • economydrug-ely
  • nucara-storycity
  • peoplesrx-3
  • sinksrx-ltc
  • talkrximage-centos7
  • vicsrx1
  • vitalcareinfusionservices-keller
  • wesleysdev
  • millstreetpharmacy
  • alliedpharmacy
  • as-salampharmacy
  • expressrx-prescott
  • greenhillpharmacy2
  • hillsdrugstore
  • idabelexpresspharmacy
  • indydrugco
  • k-cpharmacy
  • locost-savannah
  • mccarthyspharmacy
  • morethanmedicine
  • moweaquapharmacy
  • petsandpeoplepharmacy
  • riversidepharmacy
  • u-saveitrx-pinemountain
  • pittmanspharmacyinc
  • allcarepharmacy
  • barrettpharmacy
  • boonevillepharmacy
  • caduceuspharmacy
  • crescentdrugandapothecary
  • forwardpharmacy-mcfarland
  • handsrxatchapelhill
  • heartland-auburn
  • leggettdrugco
  • portervillepharmacy2
  • thedrugstore-lincolnton
  • silveradopharmacy
  • akersrx
  • baysidepharmacy
  • bryars-warrendrugco
  • centraldrugs-lahabra
  • decaturvillagepharmacy
  • jonesmccallhealthmartrx
  • kiowacountypharmacy
  • magnoliapharmacy
  • millerspharmacy-wyckoff
  • mycareexpresspharmacy
  • nationalrx
  • paylessdrugs-birmingham
  • pelhamcommunityrx-pelmeds
  • realodrugs25
  • thepharmacia-woodholme
  • tomlinsonspharmacy
  • drugco-ahoskie
  • kettlefallspharmacy
  • riesbeckspharmacy-bridgeport
  • rileysmedicalequipment
  • u-saveitrx-leecounty
  • windroserxllc
  • drugroom
  • bmwrx
  • centraloklahomafamilyrx-arlington
  • cortezdrugs
  • friendlycitypharmacy
  • gardensdrugs-westpalmbeach
  • longbelladrug
  • medicinemanpharmacy-jfk
  • mtzcompoundingrx
  • ricks-carolinarx
  • shorelinepharmacy
  • sullivanpharmacy
  • thepharmacyathuntregional
  • adamsdrugs-tallassee
  • kingsrx-murphy
  • avitapharmacy-satx-1075
  • baystreetpharmacy
  • homerdrugs
  • parvinspharmacy
  • realodrugs-chm
  • restorativecompoundingpharmacy
  • scottspharmacy-macon
  • vitalcareofpalmdale
  • hilltoppharmacy-clarksville
  • advancedcareofomro
  • bordelonssupersavepharmacy
  • kratzershometownrx-mountorab
  • madisonapothecary
  • mainline-rx-hastings
  • mm-medcare
  • advancecarepharmacy
  • bettercarerxpharmacy
  • lexingtonchemist
  • medicap-8082
  • mlkpharmacy
  • nucara-nevada
  • paul-test
  • phippspharmacy-hunningdon
  • premierzephyrhillspharmacy
  • primarycarepharmacyservices-westmifflin
  • ramtownpharmacy
  • reedspharmacy1-berkeleysprings
  • tiffanynaturalpharmacy
  • tomsriversidepharmacy
  • westconcordpharmacy
  • goldendrug-richfield
  • zayanpharmacy
  • autobuild
  • avalonpharmacy
  • avitapharmacy-portland
  • carerxpharm
  • cornerstone-rosecity
  • familyhealthpharmacy
  • jeromedrugs
  • laduepharmacy
  • lorexdrugs
  • maddoxdrugs
  • pharmacyofdunlap
  • pharmacysolutions-arlington
  • piedmontdrug
  • realodrugs6
  • sunrx
  • wamegodrugstore
  • everwellspecialtypharmacy
  • avitapharmacy-washingtondc
  • foothillsrx
  • keeverrx
  • latiendapharmacy
  • nordicpharmacy
  • talkrximage
  • candlerrx
  • einsteinapothecary
  • freelandbrownpharmacy-1
  • gil-cofaithpharmacy
  • harperpharmacy
  • medicineshoppe-sandiego
  • newenglandpharmacyandwellness
  • plazapharmacy
  • prestonspharmacy
  • villagerx-gardendale
  • nuripharmacy
  • adamspharmacy
  • avitapharmacy-greenville
  • brownpharmacy
  • bryancollegestationchc
  • communityhealthcare-tacoma
  • dalydrug
  • hometown-mountvernon
  • hopehealthpharmacy-pineneedles
  • niagaraapothecary
  • openvpn-test
  • pharmacyplus-greenfield
  • pinebrookrx-1
  • solusrx
  • toledoclinic
  • oceanparkrx
  • bandysrx-irvington
  • columbiaheightspharmacy
  • hancockpharmacy-v
  • heartland-mtnhome
  • kindredcarepharmacy
  • lukesfamilypharmacy
  • martindrugdba-thriverx
  • premiercarepharmacy
  • semodrug
  • sutterpharmacy
  • thepharmacyatpjbean
  • trinitypharmacy
  • turnersdrug
  • wichitacountypharmacy
  • hugoexpresspharmacy
  • halifaxdrug
  • carefirstpharmacy
  • cambridgehealthalliance-cabot
  • gerouldsrx-3
  • homewoodpharmacy
  • hospitaldiscountrx-central
  • josephrx-newyork
  • lilyspharmacy
  • medcentapharmacy
  • pinebrookrx-4
  • qdpharmacy
  • rxclinic-harrisblvd
  • vhs-atlanticshores
  • giantdiscountdrugs
  • medicalcenterpharmacy-gastonia
  • accuserv
  • alivationpharmacy
  • donganhillspharmacy
  • madisonaverx
  • mainst-pharmacy
  • orangecutratedrug
  • petersburgrexalldruginc
  • rosecitypharmacy
  • rowlandoldmainpharmacy
  • spalittospharmacy
  • qvspharmacy-3
  • carefreecompoundingandwellness
  • familycarerx-tysons
  • hill-city-pharmacy3
  • hollisdrugsandsurgical
  • johnspharmacy-charleston
  • justicepharmacy
  • means-laufsuperdrug
  • monarchpharmacy
  • oldpasadenarx
  • seymouradvaluepharmacy
  • tysondrugs
  • smithscountryclubdrugstore
  • avance-care-pharmacy
  • bullochsdrugstore
  • callsign-nyc-1
  • chowchillapharmacy
  • crchcpharmacy
  • cwp-homestead-1e41
  • dreierpharmacy
  • harrisburgclinicpharmacy
  • mayerspharmacy
  • mckenneypharmacy
  • newronsondruginc
  • newwalkerspharmacy
  • chrispharmacyofgonzales
  • clarksdalepharmacy
  • silverrodpharmacy
  • threebearspharmacy-kenai
  • wombledrug
  • clevelandlowcostpharmacy
  • cornerstone-rogers
  • dannyspharmacyii
  • folsepharmacy
  • garyandleospharmacy
  • hudsondrugshop
  • kingsrx-parkslope
  • owlbusinessoffice
  • physicianschoiceinfusion
  • prescriptioncentresurgicals
  • quinnfamilypharmacy
  • sandjpharmacy-sanger
  • southwoodpharmacy
  • stovallsprescriptionshop
  • theburghpharmacy
  • u-saverx-grandisland
  • unionltcpharmacy
  • acediahealth
  • basaltclinicpharmacy
  • cobornsrx-2038
  • cwp-coralgate-1b39
  • guyspharmacy-crystalsprings
  • ivyspecialtycompounding
  • meyerrx
  • southernrx
  • summersrx-butler
  • wellnessfamilypharmacy
  • medchoicepharmacy-denison
  • bluegrassdrug-carrollton
  • cornerstone-markham
  • guffeysdrugstore
  • homerxhealthcare
  • longevityscripts-fortmyers
  • lopezislandpharmacy
  • madisonparkpharmacy
  • u-save-pharmacy-south
  • vicklundpharmacy
  • watertowndrugs
  • stotlardrugcompany
  • tuscaloosadrugcapstone
  • redcarpetpharmacy
  • oldbridgedrugsandsurgicals
  • bannerdrug-downtownstatesville
  • 501pharmacy
  • asheville-compounding
  • bestchoicepharmacy
  • expressrx-joplin
  • familycarediscount
  • firstcarepharmacy-hays
  • hinashomecarepharmacy
  • lakehillspharmacy
  • medellapharmacy
  • medicaltowerpharmacy
  • okolonapharmacy
  • parkvillepharmacy
  • teamspharmacycorp-medicinetogo
  • threenotchpharmacy
  • uniontownmedicalpharmacy
  • valleydrug-everson
  • bootheeldrugs
  • cannonrx-mooresville
  • cullfamilypharmacy
  • cwp-kendall-1d05
  • erik-ivr
  • gwinnettdrugs
  • jimsu-savepharmacy
  • johnspharmacy-capegirardeau
  • klamathtribalhealth
  • medicinecenterrx-louisville
  • medicineshoppe-baltimore
  • mendpharmacy
  • northsideapothecary
  • palacepharmacy
  • spagespharmacy
  • thepharmacyatcmc
  • tulalipclinicalpharmacy
  • tulaneuniversitycampushealth
  • barrachinapharmacy
  • bypassrx5
  • cascadesinsurance
  • emmausdrugstore
  • evanspharmacy-stockton
  • lifelinebaltimorepharmacy
  • peachtreehealthpharmacy
  • pembertonpharmacy-salisbury
  • quinlanspharmacy
  • raymondrx
  • westmilfordpharmacy
  • my-beta
  • kirbywhittenpharmacy
  • avitapharmacy-austin
  • bellin-health-meds-wrightstown
  • cornerstone-littlerock
  • cwp-linton-bb05
  • cwp-olathe-1e98
  • gallatinprescriptionshop
  • greenportdrugsllc
  • hometown-hopewell
  • keydrugs-poplarbluff
  • lumbertonhealthcenter
  • minutesrxpharmacy
  • shriverspharmacy-logan
  • williamsburgdrugco
  • harrisdrugstore
  • longrx
  • welltopiarx
  • arnzensglenwoodpharmacy
  • cwp-e-hialeah-cb55
  • dakotadrugofstanley
  • kubatrx-fremont
  • malvernfamilypharmacy
  • nucararx-coralville
  • peninsulacompounding
  • dightonpharmacy
  • pooler-pharmacy
  • professional-rx-rosedale
  • vowlab
  • vytosrx-kennedy
  • princetondrug-ky
  • chancydrugs-northvaldosta
  • riverwoodmcgregorclinicrx
  • professionalpharmacy-dalton
  • alafiyapharmacy
  • apothicareatlakewoodranch
  • araratpharmacy
  • avitapharmacy-jackson
  • danielspharmacy-denmark
  • franklinpharmacy-wichitafalls
  • lakewylie-pharmacy
  • medfirstpharmacy
  • stonegatepharmacy-broadway
  • medicinemanpharmacy-northbend
  • finleypharmacy
  • ashvilleapothecary
  • barkerspharmacy
  • barrysmontvillepharmacy
  • berneyspharmacy
  • brame-temp
  • crystalpharmacy
  • familycarerx-mc
  • goodlarkpharmacy-fairview
  • lowellcommunityhealthcenterrx
  • medicalpark-dublin
  • medsourcescripts
  • oldtownclinicpharmacy
  • oneals-belhaven
  • peoplesrx-1
  • southernvillagerx
  • stonespharmacyinc
  • vowuniversity4
  • wannamakerdrug-chesterfield
  • cloquetmedicineshopperx-skyline
  • andrewsapothecary
  • carrollpharmacy
  • cwp-sw8thstreet-f508
  • fresnomedicineshoppe-marksave
  • kpharmacy
  • medicinemanpharmacy-omaha
  • neighborhoodfamilypractice-ridge
  • peninsulapharmacy
  • peoplespharmacyandfoodmart
  • petersonpharmacy
  • reedspharmacy2-hedgesville
  • rumsonpharmacy
  • simplywellspecialtyrx
  • valleypharmacy-sugarloaf
  • whisperingpines
  • calmontpharmacy
  • careswaypharmacy
  • clarkshubcityrx
  • healthdepot-1
  • kingmandrugstore
  • mowrymedicaltemp
  • northfloridarxofbranford
  • princetondrug
  • thebeavertonpharmacy
  • baileypharmacy
  • cashwiserx-3011
  • evansdrugs-nevada
  • fairmontdrugcompany
  • healthcenterrx-winfield
  • moosepharmacy-kannapolis
  • preferred-pharmacy
  • savannahfamilyrx
  • trummdrug-clinicpharmacy
  • wyattsrx
  • abhpharmacyandmedical
  • baychemists
  • bellsfamilydrug
  • capstonepharmacy
  • gunbarrelcitypharmacy
  • kollhoffpharmacy
  • medicap-scottcity
  • minthillpharmacy
  • multnomah-westside
  • parkwaydrugs-albanyst
  • puppetcompiler1
  • southsidedrugcompany
  • stanleyspharmacy
  • stgeorgefamilypharmacy
  • thomas-drug
  • tylerbrothers
  • tritownpharmacy
  • login
  • avitapharmacy-lakecharles
  • bypassrx
  • dixie-clarksville
  • goodhopepharmacy
  • parkpharmacy
  • payless-drugs-fairfield
  • sedgleyplazapharmacy
  • stlukeslowcostpharmacy
  • thompsonspharmacy
  • u-saverx-kearney
  • medicalartsrx-henderson
  • peachtreerx
  • teleport
  • vitalcareinfusionservices-boise
  • brownsdrugstore
  • centralavenuepharmacy
  • connectcare
  • farmersuptownpharmacy
  • goldsmithmedicenterrx
  • littleneckdrugstore
  • medicalcenter-hickory
  • millersdrugstore
  • pattersonfamilyrx
  • unionmedicalpharmacy
  • walhallapharmacy
  • walnutpharmacy
  • advancedvitalcare
  • allensmedicalpharmacy
  • aracomadrug-chapmanville
  • downtownrx-ny
  • gibsonpharmacy
  • johnsoncitymedicineshoppe
  • kellys-familyrx
  • marathonhealthcenter
  • nockleyfamilyrx-hanover
  • purdycostlesspharmacy
  • rosauerspharmacy-09
  • valuemartrx
  • vrxsolutions
  • wellcenterpharmacy
  • realodrugs13
  • villagewellness-ladylake
  • cambridgehealthalliance-revere
  • majoriadrugs5
  • peoplescompoundingcenter
  • sincererxhometownpharmacy
  • upstreampharmacy
  • cumberlandpharmacy
  • marshallmedicpharmacy
  • pacificapharmacy
  • unionfamilyrx
  • vicsrx2
  • villagerx-baldwin
  • nordahlpharmacy
  • auburnpharmacy-lindsborg
  • avitapharmacy-nashville
  • cwp-miramar-f461
  • jwchpmqlynwoodrx
  • padekhealthcarepharmacy
  • petaldrugco
  • southendpharmacy-houston
  • staywellpharmacy
  • candddrugstore
  • medicinecenterrx-newphiladelphia
  • rtws.dev
  • blacktailpharmacy
  • bookspharmacy
  • digital-bubbasmedshop
  • hilltoppharmacy
  • hurricanefamilyrx-wv
  • kellyspharmacy1
  • linsonpharmacy
  • medicalcenter-piedmont
  • nucara-fairfield
  • siglerrx1
  • willowpharmacy
  • bestvaluewaddyrx
  • clevelandurgentcare
  • flatironsfamilyrx
  • hilandpharmacy
  • killdeerpharmacy
  • leerdfamily
  • northbeachespharmacy
  • premierrxandwellness
  • sheehanspharmacy
  • stanleyrx
  • test-ivr
  • yazoodrugcompany
  • buyritedrugs-havana
  • communityfirstrx-dayton
  • craigsdrugstore
  • evartpharmacy
  • grovelandpharmacy-ca
  • guyspharmacy-tylertown
  • jordanvalleycommunityhealth-grand
  • oakridgecare
  • riesbeckspharmacy-southzanesville
  • rosedrug-russellville
  • tabbfamilypharmacy
  • tablerockpharmacy
  • aberdeenpharmacy
  • biglakepharmacy
  • familycarerxpharmacy-closeddoor
  • foodgiantdiscountrx
  • lakelandpharmacy-forsyth
  • medicineshoppe-2103
  • nicholsapothecary
  • prosperpharmacy
  • univofkansas-cambridgenorthretailrx
  • easthickmanpharmacy
  • ivywildpharmacy
  • mainstrx
  • medicinemanatholpharmacy
  • pelhampharmacy
  • mcdowellspharmacyofgatescounty
  • avitapharmacy-bellaire
  • avitapharmacy-neworleans-1037
  • wheelercountydrugcompany
  • purecarepharmacy
  • aubreypharmacy
  • avitapharmacy-ftmyers
  • paylessdrugs-springville
  • richlandvillagedrug
  • silverstatedrug
  • stpaulcornerdrug
  • universalartscompoundingpharmacy
  • univofkansas-uat
  • valleypharmacy
  • westmainpharmacy
  • springspharmacy
  • centralpharmacy-macdonald
  • bachpharmacynorth
  • bergennewbridgemedicalcenter
  • bridgeportfamilypharmacy
  • costlessrx
  • hersheypharmacy
  • levitest
  • medicap-8023
  • portolavillagepharmacy
  • prescriptionreadyrx
  • richfieldcommunitypharmacy
  • route66pharmacy
  • trspharmacy
  • uptownuniteddrug
  • villagepharmacyoffruitport
  • royaltypharmacy
  • bellin-health-pharmacy-seymour
  • clementsdiscountdrugs
  • collegehilldrug
  • mcleod-choice-pharmacy
  • medicineshoppe-1675
  • mikesrx-pasadena
  • northwestprescriptionsandmedsupply
  • pratersrx-webbcity
  • robertjacobsonsurgicalpharmacy
  • rockhillpharmacy
  • thepharmacyplace
  • stjosephpharmacy-phillipsburg
  • auburnpharmacy-osawatomie
  • brewermedicalcenterpharmacy
  • brownsvillepharmacy
  • coatsrx
  • cwp-gastonia-1e95
  • horizonpharmacy
  • mcglynnpharmacy
  • midlandpharmacy
  • mtwelcomepharmacy
  • omnifamilyhealth-panama
  • rxexpresspharmacyofpascagoula
  • sav-morpharmacy-corporate
  • somersetparkrx
  • thepharmacyinc-bennington
  • unionhealthservice
  • diamondpharmacy
  • ivyleapharmacy
  • kapiolanimedicalcenteroutpatientrx
  • mastersspecialtyrx
  • new-middletown-rx
  • redcrosspharmacy
  • seitzdrugcompanyinc
  • skidmorepharmacy
  • valleywidepharmacy
  • stocktonpharmacy
  • tuscaloosadrug5points
  • broadwayapothecary
  • capepharmacy
  • chancydrugs-adel
  • durandtelepharmacy
  • expresscarepharmacy
  • kiowahealthmartrx
  • mainstpharmacy
  • oneiropharmacy
  • professional-rx-williamsburg
  • sheefapharmacyandwellness
  • shriverspharmacy-loudonville
  • wecarerx
  • westreadingdrugstore
  • acresrx
  • chaffeedrugstore
  • dylanscottagebakery
  • familyhealthcenter-stgeorge
  • frontrangepharmacy
  • gandmpharmacy
  • horseshoe-temp
  • kratzershometownrx-lebanon
  • managed-print
  • mizellesdiscountdrug
  • neighborhoodfamilypracticepharmacy
  • pinetopspharmacy
  • powerspharmacy
  • rapoportpharmacy
  • realodrugs10
  • seriospharmacy
  • villagepharmacy-gilbert
  • rxexpresspharmacyofcommack
  • lennysrichfieldfamilyrx
  • yorkepharmacy
  • bolivardrug
  • greenpharmacy
  • hayatrx-17
  • healthyurxinc-williamst
  • hogans-pharmacy
  • hugosfamilypharmacy-7
  • ihcpharmacy
  • jamespharmacy
  • u-saveitrx-commerce
  • u-saveitrx-downtown
  • u-savepavilionpharmacy
  • api-lumistry
  • adamsdrugs-chantilly
  • avitapharmacy-charleston-1056
  • centralpharmacy-nj
  • cornerdrugs-chatsworth
  • fannininfusionpharmacy
  • funkpharmacy
  • healthcarepartners-marion
  • lakemurraydrug-irmo
  • medicineshoppe-fishkill
  • medimaxpharmacy
  • pharmacyplus
  • sayreprofessionalpharmacy
  • supervaluepharmacy
  • vinniespharmacy
  • api-gw
  • laudenpharmacy
  • mccoytygartdrugstore
  • zach-test
  • bergenlinedrugs
  • duprepharmacy
  • empirespecialtyrx
  • hamburgpharmacy
  • hayatrx-5
  • lantzsrx
  • laquintapharmacy
  • madisonmedicalpharmacy
  • medicineshoppe-danielsville
  • paxpharmacy-ii
  • realodrugs5
  • wolcottpharmacy
  • yorkwellnesspharmacy
  • avitapharmacy-orlando
  • bennettfamilypharmacy
  • chrispharmacy-maurepas
  • clovercarepharmacy
  • colonianaturalcare
  • cwp-newbraunfels-1b50
  • essentialrx
  • galtpharmacy
  • hallerspharmacy
  • jacksmarketpharmacy
  • maderamedicalpharmacy
  • medicap-8256
  • morton8thstpharmacy
  • clintondrug-nc
  • frickspharmacy
  • registercliffpharmacy
  • crescentcommunityhealth
  • avitapharmacy-winnetka
  • cfh-biloxi
  • hospital-washington
  • johnspharmacy-puxico
  • rockcreekrx
  • villagehealth
  • skylinepharmacy-fortworth
  • vitalcare-jackson
  • citycarerx
  • cwp-midtown-1e97
  • duvallfamilydrugs
  • everettspharmacy
  • hrxpharmacy
  • jonesboroughmedicineshoppe
  • kernersvillepharmacy
  • macpharmacy-4
  • medicenterpharmacy-carterville
  • medz2home
  • newportcenterpharmacy
  • realodiscountdrug-trenton
  • summitrxpharmacy
  • trummdrug-parkersprairie
  • aandapharmacy-leland
  • avitapharmacy-lamont
  • bestvaluecustommeds
  • citypharmacy-springdale
  • colfaxpharmacy
  • conwaysdanvillepharmacy
  • geneseopharmacy
  • gooddayrx-dougs
  • heb-demo
  • hokesbluffdrugshoppe
  • northchesterpharmacy
  • phippspharmacy-jackson
  • adelhealthmart
  • atkinspharmacyservices
  • avitapharmacy-elysian
  • brickcitydrugs
  • citydrug-clayton
  • leesilsbycompoundingpharmacy
  • medicineshoppe-baldwin
  • medicineshoppe-columbiapa
  • rosauerspharmacy-02
  • rxculpeper
  • veniceapothecary
  • vitalitydrugandsurgical
  • goodlifepharm
  • superemacarepharmacy
  • clinicdrug
  • shriverspharmacy-dresden
  • 72ndstpharmacy
  • calabasaspharmacy
  • clearwatercanyonrx
  • lumbertondrug-west
  • nehalembayhealthcenter
  • sandcastlepharmacy
  • vaughnpharmacy
  • westatlanticpharmacy
  • wholescriptspharm
  • t-dpharmacyinc
  • bayridgerx
  • brandonmedicineshoppepharmacy
  • cwp-quailroost-ca64
  • danspharmacy
  • getwellpharmacy
  • gooddayrx-johnstown
  • groveparkpharmacy
  • kch-outpatient-pharmacy
  • medicalpharmacysouth
  • oldforgepharmacy
  • oxfordpharmacy
  • palmettopharmacymedicineshoppe
  • rivercitypharmacy
  • robalopharmacy
  • southgatedrug
  • starcarepharmacy-arizona
  • stmaryspharmacy
  • vcarepharmacy-newhampshire
  • webberpharmacy
  • woodlanepharmacy
  • pinonfamilyrx
  • truepharmacy-easley
  • brickcitycompounding
  • clinicrx-devilslake
  • greenparkcompoundingrx
  • guyspharmacy-summit
  • hancockpharmacy-vi
  • hayatrx-19
  • healthdepot-2
  • mountaincarepharmacy
  • parklandrx-ironton
  • puppet-tlsopus-test
  • whitestonepharmacy
  • theprescriptionshop
  • choicespecialtyrx-woodlands
  • eltejonpharmacy1
  • granitepharmacy-libby
  • medicineshoppe-lancaster
  • morganrx-williston
  • osteenspharmacy
  • puppetlb
  • smackoverpharmacy
  • stuartdraftfamilypharmacy
  • swisherandlohse
  • vitalcare-canton
  • wilsonfamilypharmacy
  • woodinvillepharmacyinc
  • ritterexpresspharmacy
  • hardiesdrugstore
  • eaglerockpharmacy
  • basinpharmacy
  • daytondrugandwellness
  • delmarvapharmacy-princessanne
  • gracecommunitypharmacy
  • grandaverx
  • medicinemanprairiepharmacy
  • mountairydrug
  • precisionpharma
  • robinsonspharmacy
  • sheligadrug
  • siglerrx2
  • tallulahpharmacy
  • battsdrugcompany
  • hartsvilledrug
  • hartzellspharmacy
  • lakelandrx-bransonwest
  • medicinemart-gaffney
  • owltri-statepharmacy
  • parishpharmacy
  • southrivercompoundingrx-westend
  • willowbrookpharmacy
  • centerdrugsofdaleville
  • longbeachrx
  • byrd-watsonrx
  • castellonpharmacy
  • citydrugs-grovehill
  • cordespharmacy
  • cwp-ipsec
  • easyrx-holyredeemer
  • hawthorne-taylor
  • hometown-marshall
  • jimspharmacyatthelake
  • mednorthhealthcenterrx
  • pratersrx-seneca
  • theclinicpharmacyinseminole
  • thompsonslakecountrydrug
  • vitalpharmacy
  • willowspharmacy
  • expressrx-cantrell
  • obrienanddobbinspharmacy
  • surecarepharmacy
  • u-saverx-north-platte
  • cwp-stateave-1e96
  • libertymedicenterpharmacy
  • longleyspharmacy
  • richiesspecialtypharmacy
  • rochellepharmacy
  • simonsdiscountpharmacy
  • thepharmacyatdesoto
  • ben-test
  • bestvaluerenshawdrug
  • boazdiscountdrugs
  • cubdrug
  • donsrx-porttownsend
  • doughertyspharmacy-mcalester
  • familydrugmart-slidellwest
  • giantgeniepharmacy
  • knoxprofessionalpharmacy
  • martinspharmacy-pulaski
  • newpharmacy-29palms
  • pharmasavemonroe
  • popkesspharmacy
  • stoutstreethealth
  • washoetribalhealthclinic
  • prosperitydrug
  • ahfpharmacy
  • cokerhamptondrugcompany
  • funderburkspharmacy
  • lakesidepharmacy-havasu
  • longliferx
  • drugworld
  • frenchtownpharmacy
  • hill-city-pharmacy
  • thriftywaypharmacyoflakecharles
  • avitapharmacy
  • avitapharmacy-nashvillemeharry
  • callsign-sfo-1
  • communitycarerx-malvern
  • hancockpharmacy-vii
  • leescitydrug
  • lincolnprimarycarerx
  • mainline-rx-murrysville
  • mclaughlinsdrugstore
  • merryfieldpharmacy
  • qualitycarerx
  • staniferdrugs
  • stoneplazapharmacy
  • summersrx-clintonclinic
  • boydspharmacy-mansfield
  • camelbackcompoundingpharmacy
  • freedompharmacy-hattiesburg
  • goodlarkpharmacy-dickson
  • hickoryhillrx
  • katzpharmacy
  • beggspharmacy
  • bestyethealthmartpharmacy
  • childrenspharmacyservicesnew
  • farmaciaviva
  • hayatrx-16
  • kleins-kchc
  • martinsvillepharmacy
  • medonepharmacy-thurmont
  • middleportfamilyhealth
  • prestondrug
  • walterboropharmacy
  • 986pharmacy-lakearrowhead
  • austinspharmacyinc
  • dailydosepharmacy
  • edsmedicenter
  • expressdiscountpharmacy
  • goldenvalleyrx
  • medicineshoppe-newportrichey
  • phippspharmacy-mckenzie
  • smyrnamedicineshoppe
  • gussdrug
  • citydrug-coweta
  • douglasmainpharmacy
  • ihs-jeffersonville
  • medicap-8213
  • meridianhealthcare
  • pharmacyarts
  • quickstop
  • sozowellnesscenter
  • waynesboro-apothecary
  • wurlitzerfamilypharmacy
  • lawsonspharmacy
  • acedrugs
  • apotheworx
  • capitalregionalrx
  • carmichaeldrugs-vitalcare
  • cashwiserx-3041
  • citihealthrx
  • cornerstoneapothecary-vanhorne
  • dimaspharmacy
  • donellspharmacy
  • ferndalepharmacy
  • healthsmart-newton
  • marshlandpharmacy
  • medi-thriftlafayette
  • saterpharmacy
  • scriptcopharmacy
  • semmespharmacy
  • test-ae
  • westburyrx
  • yostpharmacy
  • hometownpharmacy-richmond
  • purepharmacy
  • accuserv-ltc
  • bigcdiscountdrugs
  • buyritedrugs-portstjoe
  • calebshometownrx
  • communitycarerx
  • first-carerx
  • klingensmithsdrugstores-kittanning
  • kremerpharmacy
  • thornedrug
  • vitalcareofmadison
  • woodbridgepharmacy
  • vitalcare-springfield
  • brinkleyfamilypharmacy
  • amberwellpharmacy-atchinson
  • briargroverx
  • bubbasmedshop
  • citymedspharmacy
  • davycrockettrx
  • ipsectest1
  • lincolnpharmacy-albany
  • lowrysprescriptions
  • marionfamilyrx
  • mcleskey-todd
  • medicap-8230
  • mmcpharmacy
  • northlakepharmacy
  • potterdrug-athens
  • preferredrx-loudon
  • realodrugs24
  • roundrockisdpharmacy
  • sevenlakes
  • u-saveitrx-griffin
  • vowuniversity1
  • westendpharmacy
  • leonardpharmacy
  • wolkardrug
  • add-drug-ltc
  • heartland-bentonville
  • hieberspharmacy
  • magicmartpharmacy
  • richmond-hill
  • matawanpharmacy
  • applediscountdrugs-2
  • elkhornpharmacy
  • enexiaspecialtyrx-portrichmond
  • thechosenpharmacy
  • centerdrugs-geneva
  • yellowstonepharmacy
  • u-saverx-mccook
  • auburnpharmacy-garnett
  • bestvalueroycesrx
  • centralpharmacy-weslaco
  • expressrxpharmacyandmedsupplies
  • omropharmacy
  • ralphsfamilypharmacy
  • u-savemilfordpharmacy
  • willacoocheepharmacy
  • adamsdrugs-copperfield
  • api
  • commwellhealthdiscountpharmacy
  • cornerdrug-coloradocity
  • culinarypharmacyi
  • cwp-pahrump-1e43
  • kexrxpharmacy-horton
  • kingslandpharmacy
  • lakeviewpharmacy-racine
  • lovelldrug
  • medicalartschemists
  • onamiadrug
  • ripleydrugs
  • wrensdrug
  • northunionmedicineshoppe
  • cascaderx
  • bigforkdrug
  • bsmcpharmacy
  • bypassrx3
  • carefirstspecialtypharmacyllc
  • crittendens-drug
  • digital-whartonpharmacy
  • eastmandrugs
  • hancockpharmacy-1
  • hiawasseehometownpharmacy
  • pacificmedicineshoppe
  • professionalcenterpharmacy
  • valleypharmacy-seymour
  • gibbspharmacy
  • betterlifepharmacy-grove
  • capecodhealthcare-capecodhospital
  • colemanpharmacy
  • expressrx-carthage
  • haydenpharmacy
  • hometown-clinic
  • macpharmacy
  • orangetreerx
  • popularpharmacy
  • summitexpresspharmacy
  • vcarepharmacy-ct
  • wrightpharmacy-stuart
  • bigsandyrx
  • cobornsrx-2008
  • cwp-45thstreet-fc56
  • healthcarepartners-sc
  • lawrencedrug2
  • lynnspharmacy-hewitt
  • medicalcentrepharmacy
  • medicineshoppe-rapidcity
  • nucara-lisbon
  • peninsulapharmacyplus
  • pepperellfamilypharmacy
  • truepharmacy
  • villageshirespharmacy
  • vowtest
  • lagunawoodspharmacy
  • linkpharmacy-lakeland
  • pineridgepharmacy
  • andersondrug
  • avitapharmacy-chicago
  • bestvaluewestrx
  • bondcountypharmacy
  • bunndrug
  • cwp-w-hillsborough
  • fulmerusavepharmacy
  • kaweahhealthpharmacy
  • keydrugs-dexter
  • lemonaidcommunitypharmacy
  • margolispharmacy
  • ohdepharmacy
  • oldephillypharmacy
  • avitapharmacy-nhollywood
  • farmaciacaridad9
  • fredericapharmacy
  • maconcitydrugstore
  • macpharmacy-3
  • medicarx-bardstown
  • michaelsprescriptioncorner-hobbs
  • porterfamilyrx
  • prevodrug
  • smithgallspharmacy
  • westmoreland-jeffersonville
  • crestrxpharmacy
  • applerx
  • carepharmacy
  • lakecountryrx-eatonton
  • lowesdrugs
  • medicpharmacy
  • mypharmacy-piscataway
  • pencolcompoundingpharmacy
  • stroudcompoundingdrugstore
  • u-saveitrx-adel
  • valumed-ftgibsonpharmacy
  • 4-corner-rx
  • birdsboropharmacy
  • gideonpharmacy
  • kawaiolapharmacy
  • battens-prescription
  • cayucospharmacy
  • chocowinityrx
  • gonzalesrxpharmacy
  • jnrpharmacy
  • larkincommunityhospital-palmsprings
  • medicinemannorthpharmacy
  • medsave-nicholasville
  • oaklandrx
  • savondrugshealthmartpharmacy
  • shriverspharmacy-zv2
  • southernstarrx-002
  • sugarspoonhometownpharmacy
  • val-u-medhealthmart
  • ashevillemountainrx
  • avitapharmacy-austin1
  • bonapartepharmacy
  • dilloncommunitypharmacy
  • dupontcirclerx
  • goodrichpharmacy-andover
  • hillcrestpharmacync
  • palmharborrx
  • w5pharmacy
  • alvaradopharmacysd
  • boonememorialpharmacy
  • cobornsrx-2031
  • deltapharmacy-riovista
  • khangpharmacyllc
  • hometown-lexington
  • invictusventures-hq
  • frdsav-morpharmacy
  • avitapharmacy-salisbury
  • blythewoodpharmacy
  • expressrx-vardaman
  • granitedrugcenter
  • helenadrugs
  • kubatrx-fremonthme
  • mypharmacy-greensboro
  • ncapharmacy
  • ridgewaypharmacy
  • wesleysdev-fluent-two
  • berkeleyhome
  • carefirstspecialtypharmacy
  • chambersapothecary
  • dennisrx
  • grantspasspharmacy
  • realodrugs2
  • sanandreaspharmacy
  • vialidodrugs
  • riesbeckspharmacy-shadyside
  • barnesarcatafamilydrug
  • fairfieldcommunityhealthcenter
  • hoganspharmacy-ga
  • lawtonheritagepharmacy
  • mainline-rx-nanty-glo
  • reedspharmacy
  • smartmedprescriptioncenter
  • cwp-pineisle-f513
  • familycarerx-university
  • familyrx-vernon
  • herrindrug
  • hometown-campbellsville
  • liveoakpharmacy-plano
  • medicap-8281
  • pharmoryrx
  • realodrugs-fouroaks
  • reidhospitalpharmacy
  • sav-ritepharmacysouth
  • smalltownpharmacy
  • talkrximage-vultr
  • vanguardpharmacy
  • westatlanticdiscountpharmacy
  • westgatepharmacy
  • mikesmedicalpharmacy
  • bellin-health-pharmacy-memorial
  • clarindaregionalhealth-communitypharmacy
  • gooddayrx-greeley
  • hamptonpharmacy
  • hocks-piqua
  • kellyspharmacyandcomp
  • maddenspharmacy
  • medicineshoppe-stcharles
  • riverwoodgarrisonclinic
  • rochestercarerx
  • rolsethdrug
  • saintmariapharmacy
  • somcpharmacy-main
  • usavepharmacy-lexington
  • villagrovepharmacy
  • abeldtsgaslightpharmacy
  • advancedrx060
  • bestvaluedansrx
  • dinubapharmacy
  • familyrx-enid-3
  • gooddayrx-springcreek
  • hayatrx-22
  • hometown-frankforteast
  • medicineshoppe-phelan
  • medworkspharmacy
  • primespecialtypharmacy
  • springbranchpharmacy
  • victorsmedicenter
  • wrightpharmacy
  • twainhartepharmacy
  • cashiersvalleyrx
  • creswellhealthmartrx
  • healthsmart-startown
  • jerseyshorepharmacy-barnegat
  • meccarx
  • medinamedicineshoppe
  • norlandavenuepharmacy
  • realo-extendedcare
  • selmapharmacy
  • tallentdrugstore
  • toddsrx-camden
  • whiteoakpharmacy-nutley
  • heliosrx
  • grizzlypharmacy
  • blackburncenterpharmacy
  • downtowndrug-co
  • empireprofessionalrx-glenburnie
  • hometown-frankfortwest
  • kreislercountrypharmacy
  • niemannharvestmarket
  • redappleinteractivepharmacy
  • sav-morpharmacy-neoga
  • scripx
  • shriverspharmacy-mcarthur
  • somcpharmacy-south
  • townshipprofessionalpharmacy
  • clearlakeprofessionalrx
  • eastsidepharmacy
  • familyprescriptioncounter
  • integrityrx-somerville
  • millsfamilypharmacy
  • nucara-ackley
  • parisapothecary
  • reinbeckrx
  • savcopharmacy
  • summersrx-clinton
  • themedicineshoppe-ridgway
  • threebearspharmacy-butte
  • tinrx-808
  • candlerprescriptioncenter
  • cwp-delray-f506
  • firstchoiceprimarycare
  • parklanddrugs-cavecity
  • pillboxpharmacy-waco
  • saenzmedicalpharmacy-lonestarplaza
  • spartapharmacy
  • villagespharmacy
  • vowuniversity8
  • you1stpharmacy
  • moosepharmacy-mtholly
  • wagnerpharmacy
  • apothecarepharmacy-radcliff
  • evansdrugs-bolivar
  • familyrx-jonesboro
  • houserdrugcompany
  • papasfarmacia
  • reedspharmacy5
  • smithsstationpharmacy
  • thompsondrugsouth
  • valuerx-burgaw
  • goldenislesrx
  • bemisdrug
  • goodsonpharmacy
  • healthsmart-conover
  • highland-albuquerque
  • hopepharmacy
  • kamailio-nyc3
  • klingensmithsdrugstores-westkittanning
  • lombardpharmacy
  • medicap-catawba
  • saenzmedicalpharmacy-north
  • scheurerfamilyrx-pigeon
  • shriverspharmacy-athens
  • thibodauxregionalpharmacy
  • u-saverx-bainbridge
  • clinicpharmacy
  • cwp-orchardpark-1d21
  • omniprescription
  • owegopharmacy
  • alisalltcpharmacy
  • avitapharmacy-wcovina
  • hayatrx-8
  • johnspharmacy-corporate
  • lauraspharmacy
  • nucara-lenox
  • pharmacyplus-roodhouse
  • puppetdb
  • valleywiderxanddme
  • vitalcare-greenville
  • lookoutpharmacy
  • bentonpharmacy
  • applecapstone
  • familycarehealthcenters
  • aronspharmacy
  • cwp-n-miamibeach-df80
  • heartland-cabot
  • meadowcrest-gretna
  • orangepharmacy
  • palmcare-sandiego
  • sectionpharmacyinc
  • trinityvalleypharmacyllcretail
  • wellnesspharmacy
  • accesshealthpharmacy-fayetteville
  • betterlifepharmacy-garwood
  • innovarx-ii
  • josefs-mainst
  • kleins-front-street
  • littledrugs
  • northlakemedical
  • somcpharmacy-ironton
  • southernstarrx-006
  • tremontoncommunitypharmacy
  • velvadrug
  • vincentsdrugstore
  • choicepharmacy-florida
  • gabepharmacy
  • guyanvalley
  • heartofflorida-belleview
  • henryrobertsexpresspharmacy
  • inlandpharmacy
  • medicinecenterrx-minerva
  • montevistapharmacy
  • multnomah-northportland
  • nourpharmacy
  • badriverclinicpharmacy
  • cobornsrx-2046
  • cornerpharmacy-greenfield
  • gordonfamilyrx
  • vitalcareofmelbourne
  • medquickpharmacy
  • harrisburgmedicineshoppe
  • hillcrestpharmacy
  • kingpharmacy
  • roysecityrx
  • soundspecialtypharmacy
  • westportpharmacyllc
  • a-1pharmacymetairie
  • avitapharmacy-1079-montgomery
  • bassrutledgedrugcompany
  • cityrexalldrugs
  • healthonsouthrx
  • lumistry.dev
  • medicalhomepharmacy-southbroad
  • medicalpharmacy-uwharre
  • yatespharmacy
  • andrewspackagingpharmacy
  • beavertonpharmacy
  • centraliapharmacy
  • chemistonbay
  • crmcoutpatientpharmacy
  • cwp-hillsboro-ac53
  • danswellnessrx
  • fbthomasdrugstore
  • fiverivers-familyhealthcenter
  • hironsdrug2
  • majoriadrugs6
  • martinspharmacy203
  • medicineshoppe-sanbenito
  • midmichigancommunityhealth
  • rockfishrx
  • sanysidropharmacy
  • themedicinecabinet
  • towerpharmacy
  • u-saveitrx-franklin
  • muskegonfamilycarepharmacy
  • olympiacompoundingpharmacy
  • medicap-8269
  • adamsdrugs-prattville
  • collinsvillefamilypharmacy
  • commonwealthrx
  • innovapharmacyofardenarcade
  • westcoastrxpharmacysantabarbara
  • winchesterpharmacy
  • mtwelcomepharmacyprincesses
  • westownpharmacy
  • accesshealthpharmacy-glendaniel
  • clarksfamilypharmacy
  • doradopharmacy
  • grueneroadpharmacy
  • js-wilsonville
  • marionpharmacy-crisfield
  • medicineshoppe-duquoin
  • memorialregionaloutpatientrx
  • parkprofessionalpharmacy
  • reeffamilypharmacy
  • sessermedicenterrx
  • wiregrasscommunitypharmacy-ashford
  • hubbarddrug
  • avitapharmacy-brea-125
  • enterprisesvcs-test
  • greensboropharmacy
  • harbordrug
  • kratzershometownrx-middletown
  • marketplacepharmacy-rockhill
  • medicenterpharmacy-carbondale
  • pharmvilledrug
  • riesbeckspharmacy-cambridge
  • themedicinestore
  • utprimarycareseviervillerx
  • vascorx
  • revelationwholesale
  • qvspharmacy
  • cornerstoneapothecary-marengo
  • elliottplazapharmacy
  • expressrx-saintjoseph
  • northparkpharmacy
  • sinksrx-corporate
  • southsiderx-springhope
  • sweetgrass-mtpleasant
  • vitalcarepharmacy-littlerock
  • pilchermcbrydedrugco
  • chateaudrug
  • dougsfamilypharmacy
  • eriepharmacy
  • foothillsprofessionalpharmacy
  • greenbaumspharmacyinc
  • hawthorne-winnsboro
  • neighborhoodconciergerx
  • northshorechemists
  • peopleandpets
  • roanmountainpharmacy
  • siegelspharmacy
  • sweetgrass-greenville
  • universalrx
  • vow-draketest
  • westcoastrx
  • peoplesrx-2
  • allcarerx
  • coasthillspharmacy
  • expressrx-tunica
  • frontierfamilypharmacy
  • goldenstatepharmacy
  • holycitypharmacy
  • hometown-georgetown
  • idealhealthmart
  • medicalcenter-rockingham
  • mondovipharmacy
  • munseypharmacy
  • piedmontpharmacy
  • riversidevillage
  • stamantpharmacy
  • wannamakerdrug
  • tts-api-prod
  • perkinsfamilypharmacy
  • abramsroyalpharmacy
  • carepharmpharmacy2
  • harborhealthandapothecary
  • henriettarx
  • islanddrug-1145
  • koblinspharmacy
  • linskypharmacy
  • lumbertondrug
  • martinsburgpharmacy
  • medicineshoppe-shillington
  • sheefapharmacy
  • swanserv-upharmacy
  • hotspringspharmacy
  • actonvalepharmacy
  • adamsdrugs-perryhill
  • ashlyn-drug
  • blairpharmacy
  • brightoncommunitypharmacy
  • carispharmacy-2
  • goodgracespharmacy
  • kellyspharmacy-delmare
  • medicineshoppe-santarosa
  • memorialhallandalerx
  • quessrx
  • thepharmacyatoceansprings
  • u-saveitrx-southalbany
  • vitalcare-greensboro
  • whitesvillerx
  • witmerdrugstore
  • qvspharmacy-2
  • backhomepharmacy
  • blountsmutualdrugs
  • bluegrassdrug-bedford
  • durenpharmacy
  • gooddayrx-longmont
  • haworthapothecary
  • lincolndrugs
  • medicalassociatespharmacy-boone
  • medicineshoppe-cloquet
  • northportpharmacy
  • peoplesdrug-lexington
  • salidapharmacy
  • sinksrx-vienna
  • thepharmacyofshannonhills
  • u-saverx-richland
  • vitalcareofhagerstown
  • avitapharmacy-philly
  • avitapharmacy-sanantonio
  • clinicalmanagementconcepts
  • familyrx-milan
  • kirksvillepharmacy
  • rosedrugofclarksville
  • stjosephpharmacy
  • wellnesspharmacy-batonrouge
  • palmcare-elcajon
  • desertlifepharmacy
  • auburnpharmacy-concordia
  • baldwinwoodspharmacy
  • bayarx-east
  • burtspharmacy-newburypark
  • careplus
  • cheekandscott-liveoak
  • fivemin-waipahu
  • hartfordpharmacy
  • harvestpharmacy
  • healthyway-sandyhook
  • nowatacitydrug
  • poetssquarepharmacy
  • ridgecrestpharmacy
  • rxinnovations
  • communityrx-monroe
  • conwellspharmacy
  • elginrx
  • greatercarepharmacy
  • lincolnspecialtypharmacy
  • losfresnospharmacy
  • medicineshoppe-whiting
  • melrosepharmacy
  • modestopharmacy
  • moultrieatcaddo
  • radcliffpharmacy
  • realtime-socket-server-centos
  • woolmarketrx
  • beddingfielddrugs
  • altruchemists
  • arrowpharmacy-carrollton
  • brooknealdrugs
  • cobornsrx-2043
  • crivitzpharmacy
  • easttallasseepharmacy
  • expressrx-ottercreek
  • highlandpharmacy-glasgow
  • mercymedicalcenter
  • phillipsfamilypharmacy
  • preferredcherokee-dalton
  • rosauerspharmacy-39
  • southpointepharmacy
  • themedicinecabinet-marksville
  • vowuniversity3
  • wendelldrug
  • c-proxy.dev
  • applerx-lynwood
  • avitapharmacy-missionviejo
  • bidwellpharmacy
  • cherokeehealth-knoxville
  • debbiespharmacy
  • edgertonpharmacy
  • hochunkhealthcarecenter-pharmacy
  • phelpscountyregional
  • quinlanspharmacy-montour
  • rawlspharmacy
  • southwesthealthsystempharmacy
  • thepharmacyatrmc
  • centralvalleypharmacy
  • ahspharmacy-lumberton
  • bandysrx-waynecity
  • castlemountaindrug
  • centraldrugstore
  • cobornsrx-2001
  • cobornsrx-2002
  • drexrx
  • easternstatescompoundingrx
  • elmerdrugs
  • lacpmqpharmacy
  • lillianpharmacy
  • medicarx-springfield
  • priority-health-care
  • woolmarketpharmacy
  • avitapharmacy-charlotte
  • clevelandmedicineshoppe
  • cornerstone-conway
  • cwp-westboca-0764
  • eltejonpharmacy2
  • friendlycitypharmacyon2nd
  • klingensmithsdrugstores-leechburg
  • kratzershometownrx-lynchburg
  • kremerpharmacy-ii
  • medicap-8160
  • medicap-8347
  • medicineshoppe-maxton
  • medisavepharmacy
  • nationscarepharmacy
  • ocracokehealthcenterpharmacy
  • pellaregionalhealth
  • seasidepharmacy
  • shriverspharmacy-crooksville
  • sinksrx-bourbon
  • southholdpharmacy
  • arlington-pharmacy
  • bayapharmacyeast
  • drugco-express
  • hayatrx-hq
  • hayspharmacy
  • medicineshoppe-1500
  • oakhurstpharmacy
  • palmerpharmacy
  • pelicandeliveryrx
  • ritevaluepharmacy-louisa
  • starkpharmacy
  • triondrugs
  • wilsoncommunityhealthcenterrx
  • avitapharmacy-florence
  • broadwayhealthpharmacy
  • conlinspharmacy
  • cwp-suncoast-2e85
  • davisbrothers-newcumberland
  • delta-iop
  • dogwoodpharmacy-nashville
  • farmvillepharmacy
  • lassendrugco
  • morristownpharmacy
  • planopharmacy
  • preferredrx-costamesa
  • sandrdrugcompany
  • gracepharmacy
  • medicalcourtpharmacy
  • avitapharmacy-nashville-1070
  • bestvaluerhomerx
  • citydrugstore-presqueisle
  • codysusavepharmacy-auburn
  • healthaidpharmacy
  • kirks-sunrise
  • medicineshoppe-1088
  • northtowndrug
  • realodrugs9
  • reddingdrug
  • northmainpharmacy
  • adamsdrugs-central
  • allhealthnetwork
  • bakercitypharmacy
  • cobigelowchemists
  • forwardpharmacy-monona
  • k-packpharmacy
  • medicalcenter-savannah
  • medicalpavilionpharmacy
  • midlandmedicalcenterpharmacy
  • premiercarepharmacy-2
  • redrockpharmacy
  • rite-valuepharmacy-inez
  • thomasdrug-gordon
  • whitmanpharmacy
  • douglaspharmacy
  • invictuspharmacy-mailorder
  • browndrug-palmyra
  • acrxspecialtypharmacy
  • hallerspharmacyandmedical
  • premiernewportricheypharmacy
  • professionalartspharmacy
  • riveroakpharmacy
  • rollingforkdrugs
  • sav-morpharmacy-virden
  • alpspharmacy
  • andrewspharmacy-ky
  • bathdrug
  • blancharddrug
  • capsulepharmacy
  • clarkcountypharmacy
  • clarkprofessionalpharmacy
  • colstripfamily-mt
  • dalcomaspecialtyrx
  • fusionmedical
  • hocks-medical
  • infinitypharmacy-cookeville
  • maplepharmacy
  • medicap-8051
  • mesquiteemployeehealthrx
  • metrowestpharmacy
  • mrsipster
  • parkplacechemists
  • portlandrx
  • priorityhealthcare-gretna
  • starlingpharmacy-ii
  • stoneoakrx
  • techeactionclinicrx-morgancity
  • valleypharmacy-derby
  • accessprimepharmacy
  • cobornsrx-2027
  • equityrx
  • harmonsdrugstore
  • kings-pharmacy
  • markspharmacy-sylva
  • quickrxdrugs-springfield
  • rawlsrx
  • rogers-moundcity
  • seaviewpharmacy
  • sierraspecialty
  • windsorcommunityhealthcenterpharmacy
  • adkinspharmacy
  • baronsdrugstore
  • bertspharmacy
  • clinchvalleypharmacy
  • communityhealthalliance-pasadena
  • cwp-elite-pembrokepines
  • farmaciareyes2-parana
  • icarepharmacy
  • medicineshoppe-1822
  • mountainlandsfamilypharmacy-provo
  • omnifamilyhealth-shafter
  • partnerspharmacy-lakemary
  • qchc-rx
  • rosecitydrug
  • techeactionclinicrx-houma
  • ameliapharmacy
  • avitapharmacy-batonrouge
  • cambridgehealthalliance-hospitalcampus
  • centos7test
  • colerhealthcare-dme
  • communitycareclintonpharmacy
  • dalessouthlakepharmacy
  • downtowndiscountdrugs
  • helenhunthealthcenter
  • highlanddrugsllc
  • hinesvillepharmacy
  • legacyspecialtypharmacycorp
  • medicalpharmacy-west-zachary
  • medicinepark-sanford
  • nucarapharmacy-grundycenter
  • plattevalleypharmacy
  • prestonscompoundingpharmacy
  • razooksdrug
  • vitalcareoforlandpark
  • hodgemancountypharmacy
  • syedpharmacy
  • fuquaypharmacy
  • aghrediscriptspharmacy
  • blackbearpharmacy
  • expressrx-fayette
  • gurdonpharmacy
  • howardfamilypharmacyofeastern
  • professionalrx-caledonia
  • upstatefamilydrugs
  • westexpharmacy-odessa
  • yubacitypharmacy
  • repo
  • rosauerspharmacy-27
  • publicdrugcorx
  • advicarepharmacy
  • burtspharmacymoorpark
  • camachopharmacy
  • charlesrivercommunityhealth
  • cherokeecustomscriptpharmacy
  • cpn
  • fergusonrexall
  • neighborhoodfamilypractice-puritas
  • newhavenpharmacy
  • nvrpharmacy
  • oakgroverxexpress
  • shieldspharmacy
  • shopandcarrypharmacy
  • shriverspharmacy-corporate
  • cwp-okeechobee-f512
  • alwanpharmacy
  • avitapharmacy-1084-dothan
  • checotahclinic
  • frenchspharmacy-morton
  • heidispharmacy
  • ledfordrxexpresspharmacy
  • olivetreecompoundingpharmacy
  • psa-rockymount
  • stanleyspecialtypharmacy
  • stephenspharmacy-honesdale
  • ulrichsvalleypharmacy
  • vinepharmacy
  • actonvalerx
  • citizenpotawatomination-west
  • coquilleindiantribepharmacies
  • corvallispharmacy
  • dentonprescriptionshop
  • lifetimepharmacy-allen
  • mccookspharmacy
  • mcdowellspharmacy
  • nativeprojectrx
  • onu-edu
  • potterdrug-4
  • villagepharmacyoflockport
  • budgetdrugs
  • demo-dp
  • dynamiccarepharmacy
  • hinasmercysouthwestrx
  • hometownpharmacy-springfield
  • jordanpharmacy
  • pricechopperpharmacy-6
  • shriverspharmacy-nelsonville
  • thedrugstore-norway
  • westsalempharmacy
  • wireless-one
  • arnoldprofessionalrx
  • bandysrx-centralia
  • chinookpharmacy
  • communitymedicalcenterpharmacy
  • curtis-washington
  • evansprescriptionpharmacy
  • hmcpharmacy-holyoke
  • houstoninfusionservices
  • infinitypharmacy
  • ionepharmacy
  • kirks-eatonville
  • puccipharmacy
  • realodrugs4
  • u-saveitrx-cordele
  • clarksrxthecompoundinglab
  • andersonpharmacy
  • cfh-leakesville
  • chehalispharmacy
  • ihs-metter
  • martellaspharmacy-franklinst
  • maxbrownpharmacy
  • my
  • readinghospitalambulatory
  • whitesellspharmacy
  • medicineshoppe-york
  • medsyourway
  • accapothecary
  • blancopharmacy
  • easternsav-mordrugs
  • genscripts-glenpool
  • leachvillediscount
  • medicineshoppe-greenvilletx
  • mmhhometownpharmacy
  • nucara-valleycity
  • okeechobeediscountdrugs
  • phillipspharmacy
  • schulz-wroten-rx
  • shippsdiscountpharmacy
  • swainspharmacy
  • u-saveitrx-pionono
  • westcarepharmacy
  • wilmingtonpharmacy
  • burkesnewriversidepharmacy
  • entmeds
  • healthinnovations-laurinburg
  • hibbitts-sc
  • jandlpharmacy
  • matthewspharmacy
  • moffetdrug
  • plainviewpharmacy
  • sunlifepharmacy-oracle
  • timspharmacy-ga
  • yeesprescriptionpharm
  • 15rxpharmacy-1
  • apothecarepharmacyv-mulberryst
  • poretsthriftywaypharmacy
  • silercityrx
  • aandapharmacy-belzoni
  • brownspharmacyandgifts
  • capecodhealthcare-falmouthhospital
  • drugcenterpharmacy
  • hayatrx-1
  • herolds-westashley
  • moscosopharmacy
  • newmadridpharmacy
  • riverview-ipsec
  • seaportcommunityhealthcenter
  • theapothecaryshop
  • waterfrontpharmacyltc
  • hickorydrug
  • websterspharmacy-altadena
  • communityhealthcare-spanaway
  • advancedmedmanagement
  • alphapeoplesdrugs
  • caldwelldrug-columbia
  • centraloklahomafamilyrx-konawa
  • coalgrovepharmacy
  • condopharmacy
  • delta-daniel-island
  • digital-avacarepharmacy
  • eaglepharmacy-lindale
  • futrellpharmacy
  • granitepharmacy-frenchtown
  • healthfirstpharmacy
  • kexrxpharmacy-atchinson
  • linospharmacy-2
  • medicineshoppe-1468
  • puntagordamedicineshoppe
  • comprehensivecarepharmacy
  • firstchoicepharmacy
  • genscripts-owasso
  • handahealthpharmacy
  • heartoffloridahealthcenter-villages
  • jacksonrx
  • khourypharmacy
  • longbelladrugbylakewood-staplesclinic
  • lyonspharmacy
  • northfloridarxoffortwhite
  • northwestcommunitypharmacy
  • prontopharmacy5
  • realodrugs20
  • sarahcarerx
  • skillzcarepharmacyinc
  • thepharmacyatstpatricks
  • expressrx-seminary
  • paysonrx
  • perkinsdrugs2
  • westdrug
  • walldrugsofflorence
  • embracepharmacy
  • cloneyslongtermcare
  • gatewaypharmaceuticalsrx
  • isakcomputing
  • northstarpharmacy
  • readinghospital7thavenuepharmacy
  • staffingassociates
  • 8thavenuepharmacy
  • amberwellpharmacy-hiawatha
  • erinlongacc
  • expressrx-miami
  • grahamrx-midland
  • idealmarket-11
  • kaweahhealthemployee
  • kirkwoodcorp
  • memorialmiramaroutpatientrx
  • springhillfamilypharmacy
  • stenniscommunitypharmacy
  • unadilladrugco
  • weslacopharmacy
  • bestvaluecountrydayrx
  • clarionmedicineshoppe
  • expressrx-coweta
  • familyhealthcenter-denmark
  • familywellnesspharmacy
  • garnerfamilypharmacy
  • goldencovepharmacy
  • hayatrx-23
  • islanddrug-1142
  • jamestownpharmacy
  • jolleysrx
  • lefavepharmacy
  • macdonaldspharmacy
  • multnomah-midcounty
  • myrtledrugs
  • picayunedrugcompany
  • price-riterx
  • rabinowitzpharmacy
  • sheridanfamilypharmacy
  • stbernardsmedicalcenter
  • sunrisepharmacy
  • citydrugofbrady
  • jandnpharmacy
  • annamedicenterpharmacy
  • bachpharmacysouth
  • bouvierpharmacy
  • braswelldrugs
  • dillesdiscountpharmacy
  • drugco-roanokerapids
  • jacksdiscountrx
  • lovelockpharmacy
  • parklandrx-farmington
  • thompsondrugdowntown
  • westhartfordapothecary
  • palisadepharmacy
  • argopharmacy
  • betterlifepharmacy-elcajon
  • citydrug-cheyenne
  • communitypharmacyoflakeview
  • dunloprx
  • expressrx-cabot
  • familyhealthpharmacy-versailles
  • familypharmacyfulton
  • hayatrx-20
  • icsrx
  • lakelandrx-willowsprings
  • nfpmedcenter
  • porterspharmacy
  • puppetcompiler2
  • realodrugs-trenton
  • sutherlindrug
  • firopharmacy
  • cambridgehealthalliance-malden
  • lanningpharmacy
  • mainline-rx-ebensburg
  • neighborhoodcarepharmacy
  • riverviewhealthrx-westfield
  • rodensmith
  • puppetcompiler3
  • lifescriptpharmacy
  • medicap-8435
  • omnifamilyhealth-stine
  • pellaregionalhealth-prairiecity
  • bramehuiepharmacy
  • colonvillagedrug
  • dailydosedrugstore
  • guyspharmacyofhazlehurst
  • hancockpharmacy-albion
  • hangerdrugs
  • lapharmacy
  • avenuepharmacy
  • accesshealthpharmacy-beckley
  • elydrugs-bowlinggreen
  • formulationcompoundingcenter
  • harvestfamilyhealthcenter
  • lakecountrycompounding
  • laketownpharmacy
  • medicap-guyton
  • medicinebin
  • mymedpharmacy
  • raleighpharmacy
  • thewoodlandscompoundingpharmacy
  • tillamookpharmacy
  • medpluspharmacy
  • castorpharmacyandsurgicalsupplies
  • aandapharmacy-hwy1
  • hixenbaughsdrugstore
  • kratzershometownrx-maineville
  • lowrydrugsandgifts
  • medicinemanpharmacy-springhill
  • morganrx-springfield
  • nucara-hawley
  • premierdrugstore
  • priceritedrug
  • rxclinic-3
  • univofkansas-westwoodcancercenterretailrx
  • bristoldiscountpharmacy
  • buyritedrugs-broad
  • etown-vitalcare
  • expressrx-pleasantview
  • highlandscommunitypharmacy
  • invictuspharmacy-livingston
  • lincolnpharmacy-tacoma
  • nucarapharmacy-ames
  • polkpharmacy
  • riverroadhealthmartrx
  • tequestadrugs
  • trailcreekpharmacy
  • somcpharmacy-westunion
  • ariacommunityhealth
  • anthony-brownpharmacy
  • avitapharmacy-lexington
  • backup
  • beverlyglenpharmacy
  • chesterriverpharmacy
  • debrepo
  • esterbrookpharmacy
  • galenpharmacy
  • gemdrugsgramercy
  • hometownhealthcare
  • johnspharmacy
  • kentstationpharmacy
  • lakemurraydrug
  • nightingale-monticello
  • ourhomerx-blairsville
  • openswan
  • bannerdrug
  • bentonharborcommunitypharmacy
  • maplerx
  • medicineshoppe-granby
  • munfordpharmacy
  • oxnarddrug
  • parkcirclepharmacy
  • pikespharmacy
  • preferredpharmacy-benton
  • reedhutchinspharmacy
  • reverehealthpharmacy
  • andersondrugs
  • apthorppharmacy
  • arrowprescriptioncenter-12
  • barondrugs
  • buyritedrugs-eufaula
  • houseofwellnesscenter-pharmacy
  • marketimedrug
  • mountainviewrx
  • pearmanpharmacy
  • rosemontpharmacy
  • signaturehealthcarepharmacy-eb
  • wilsonpharmacy
  • lakewyliepharmacy
  • altru-pharmacy
  • bryanpharmacy-elba
  • byrddrugcompany
  • grahamrx-north
  • greenspointpharmacy
  • maloneyprescriptionpharmacy
  • mastpharmacy
  • sarapharmacy
  • thompsons-neighborhoodrx
  • trummdrug-elbowlake
  • adaapothecary
  • almands-sunset
  • cashwiserx-3015
  • cwp-whaven-1e98
  • dolsontownpharmacy
  • eastberlinpharmacy
  • greenbrierrxandfountain
  • marketplacepharmacy
  • marsdenpharmacy
  • martindrugsofriverhead
  • nationwiderx
  • ostromsdrug
  • pratersrx
  • sav-morpharmacy-nokomis
  • sebastopolfamilypharmacy
  • snipharmacy
  • thriftymacdiscountdruginc
  • valleydrugs-winston
  • vitalcare-tacoma
  • wallsmedicine
  • windhamrxnorth
  • www
  • applediscountdrugs-clinton
  • brokenarrowfamilydrug-north
  • clinicrx-boone
  • cwp-ncongress-f510
  • elizabethsrx
  • johnspharmacy-altenburg
  • kaup-dme
  • lvinfusionandspecialty
  • martinspharmacy
  • pextonrx
  • pleasanthilldrug
  • quinnsfamilypharmacy-newton
  • texasscripts
  • villagepharmacyandwellness
  • wilkinsonpharmacy
  • youngspharmacyandgeneralstore
  • andersoncrossingrx
  • monfortfamilyclinic
  • pharmavidarx
  • iconpharmacy-lagunahills
  • a-1pharmacyhammond
  • apothecarepharmacy-cardinal
  • bestvaluehicopharmacy
  • boiesmedicalcenterpharmacy
  • carterdrugcompany
  • chasedrugsandclinicalservices
  • coloniacarerxandcompounding
  • healthcenterrx
  • integrityrx-monmouthjunction
  • lifepharmacy
  • medicap-glenpool
  • meierrx
  • mountainlandsfamilypharmacy-wasatch
  • neilspharmacy
  • nostrumrxpharmacy
  • pinnacleapothecary-candler
  • realodrugs-veterinary
  • realodrugs23
  • ryteshpharmacy
  • sandpointsuperdrug
  • scottsquitmanpharmacy
  • 5thavenuepharmacy
  • cambridgehealthalliance-eastcambridge
  • cobornsrx-2034
  • culinarypharmacyiii
  • desmoinespharmacy
  • hooverdrug
  • klingensmithsdrugstores-rimersburg
  • lawrencememorialhospital
  • pavilioncompoundingpharmacy
  • portalleganyrx
  • prosperityhealthpharmacy
  • rockymountainpharmacy
  • sandjmedicalcenterpharmacy-decatur
  • villagepharmacy-portales
  • seniorlifepharmacy
  • jandjpharmacy-cedarlane
  • allenfamilydrug
  • almands-tarborost
  • boonememorialoutpatient
  • coleescornerdrugs
  • communitypharmacyofgowrie
  • integratedhealthcarerx2-aop
  • jeffsprescriptionshop
  • juliantpiercehealthcenter
  • rxpharmacy
  • savencarepharmacy
  • texasroadrx-oldbridge
  • weavervillepharmacy
  • wellpackpharmacy-mountdora
  • alliancefamilyhealthcenter
  • ashlandcitypharmacy
  • carepluspharmacy
  • dropletfileserver
  • fivemin-pearlcity
  • genscripts-brokenarrow
  • notredamepharmacy
  • plumstedpharmacy
  • poconopharmacy
  • rexdrugco
  • stalbanspharmacy
  • waylandvillagepharmacy
  • whitesvillemedical
  • medicalartspharmacy
  • staging.dev
  • accesshealthpharmacy-princeton
  • aplusfamilyhealthcare
  • arnzenskamiahdrug
  • auburndalepharmacy
  • avitapharmacy-brownsville
  • eurekadrug
  • lakelandrx-crane
  • liveandletlivepharmacy
  • medicineshoppe-knoxville
  • nunallydrugstore
  • proxsysrx-corporatespecialty
  • teamsterscarerx
  • villagerx-hampstead
  • circlevilleapothecary
  • genscripts-southtulsa
  • illuminz
  • islandpharmacy-ketchikan
  • mitchellsdrugstore-uptown
  • summersrx-marshall
  • totalpharmacyservicesinc
  • arwood-drugco
  • midwestcompounding
  • sbrospharmacy
  • allenspharmacy
  • barriofamilyhealth
  • expressrx-ripley
  • loganhealthpharmacy-columbiafalls
  • medicap-8015
  • redstickpharmacy
  • optimumwellnesscenter
  • avitapharmacy-lafayette
  • barrspharmacy-blanchester
  • cornerstone-gentry
  • crosskeyspharmacy
  • hiltonheadpharmacy
  • jameshunt
  • kayrx
  • kingsdaughtersrx
  • ligonierpharmacy
  • medsave-wilmore
  • omnifamilyhealth-delano
  • springvillepharmacy
  • tmt-mgmt
  • waterfordpharmacy
  • digital-delta-monckscorner
  • crossroad-wylie
  • bertrampharmacy
  • currenpharmacy
  • fourthavenuerx
  • pattersonhealthcare-abilene
  • wasemspharmacy
  • whitemountain-showlow
  • apothecare-leesville
  • group2
  • happypharmacy
  • healthsmart-mooresville
  • louismorgandrug4
  • riverviewoutpatientpharmacy
  • send1.fax.dev
  • stonescornerpharmacy
  • tinrxatthetower
  • u-saveitrx-phenixcity
  • greenriverpharmacy
  • optumrx-nationwide
  • auburnpharmacy-camdenton
  • bascomspecialtypharmacy
  • bloomsdalepharmacy
  • bluhavenhealth
  • customedicapharmacy-eagle
  • drugco-tarboro
  • expressrxandmedsupplies
  • gentrypharmacy
  • healthcopharmacycorp
  • lexingtondiscountdrugs
  • ltcprescriptionproviders
  • medicapltc-8405
  • nucara-conrad
  • pioneerpharmacy
  • stephaniesdownhomerx
  • test-mm
  • villagerx-glenwoodcity
  • emeraldhillspharmacy
  • lifetimepharmacyandcompounding
  • thriftydrugstores
  • u-saverx-gretna
  • barrefamilypharmacy
  • freelandbrownpharmacy-3
  • murraysdrug-condon
  • parkewarnerpharmacy
  • parksidecompoundingpharmacy
  • reedspharmacy-hyrum
  • reedspharmacybrookville
  • staytonpharmacy
  • thecornerdrugstore
  • vitalcareofmequon
  • vitalscript
  • andersonpharmacy-manning
  • adlerspharmacy
  • betterlifepharmacy
  • delta-elloree
  • elktonfamilyrx
  • gilchristpharmacy-mynatt
  • grayslakeapothecary
  • hedgeshealthmartpharmacy
  • lewistownpharmacy
  • lindstromthriftywhitepharmacy
  • marketstreetpharmacy
  • pharmacyplus-usf
  • rileywhitedrugs
  • skylinepharmacy
  • sunlifepharmacy-casagrande1
  • westsidefamilypharmacyllc
  • alexrx
  • avitapharmacy-bakersfield
  • barneyspharmacy
  • brianspharmacy
  • communityrx-sterlington
  • kempfamilypharmacy
  • medicineshoppe-saraland
  • medicspharmacy
  • moultriepharmacy-langtown
  • oneals-columbia
  • surecarespecialtypharmacy
  • trinityspharmacy
  • communitypharmacy-nashvillehospital
  • familypharmacy-frontroyal
  • friendhealthpharmacy
  • martellaspharmacy-parkhill
  • medicinemanpharmacy-wahoo
  • moorespharmacy-sinton
  • pharmaxpharmacy-festus
  • puyalluptribalhealthauthority
  • theatrepharmacy
  • trinh-pharmacy
  • watertownpharmacy
  • davisdrugcompany-benson
  • medicap-8318
  • southbrunswickpharmacyinc
  • gastonfamilypharmacy
  • lakepharmacy-clearlake
  • familyrx-swansboro
  • genesispharmacyservices
  • henryjaustinpharmacy
  • jacksonmedicenterrx
  • lakindrug
  • lifetimepharmacy-frisco
  • medicap-olyphant
  • prescriptiondrugstore-caruthersville
  • scottdrugs
  • uandipharmacy
  • whartonpharmacy
  • communityhealthcare-eastside
  • centerpharmacy-capecoral
  • hmupharmacy
  • integrityhealthrx-brick
  • madisonhealthmartpharmacy
  • washingtonhealthmart
  • citydrug-maryville
  • citypharmacyofjunction
  • drex-yadkinville
  • east-tn-discountdrug
  • healthdepot-3
  • hendersondrugs
  • hometownpharmacy
  • marionmedicineshoppe
  • medicap-8095
  • thorncherryrx
  • waldendrug
  • economypharmacy-tulsa
  • oakridgepharmacy
  • bathcommunitypharmacy
  • bayarx-west
  • delmarpacking
  • fivemin-ltc
  • halecenterrx
  • harlesscenter
  • lanedrugco
  • macspharmacy-townsend
  • rannpharmacy
  • tahlequahdrugco
  • thecompoundingshoppe
  • tinrx-806
  • valuemedpharmacy-paintsville
  • bestrx-test
  • catalystrxpharmacy
  • evansdrugs
  • lovesrx-oceansprings
  • okawvillemedicenter
  • oldbridgeandsurgicals
  • omnifamilyhealth-newwasco
  • oxnardmedicineshoppe
  • rainespharmacy
  • riversidepharmacy-easthartford
  • springvalehealthcentersrx
  • steelevillerx
  • avitapharmacy-1001-losangeles
  • travsu-savepharmacy-genoa
  • neighborhoodfamilypractice-abr
  • hintonhealthexpresspharmacy
  • murrayvillepharmacy
  • avitapharmacy-atlanta
  • belvederepharmacy
  • d-rexpharmacy-yadkinville
  • dandhdrugstore-paris
  • delta-monckscorner
  • familyrx-ky
  • hayatrx-12
  • medicappharmacy-8123
  • rosauerspharmacy-10
  • schaffnerpharmacy
  • expressrx-webbcity
  • mainline-rx-altoona
  • medicalpharmacy-locust
  • redoakmedicap
  • slavins-hancockpharmacy
  • sunraypharmacy-bayshore
  • haeckervillerx
  • hillsboroughpharmacync
  • medicinecenter-dunn
  • christushealth
  • cobornsrx-2033
  • collegecarepharmacy
  • fax.ondoapis
  • forwardpharmacy-cottagegrove
  • littleacornrx
  • sandjargylepharmacy
  • trummdrug-main
  • aandapharmacy-southmain
  • davisbrothers-newcumberland2
  • georgetownpharmacy
  • hackensackmeridianvillagerx
  • hunterrx
  • laurelrx1
  • medicap-raleigh
  • medicarx-lakemary
  • nucara-paynesville
  • parkerspharmacy
  • parkhurstpharmacy
  • sav-morpharmacy-cerrogordo
  • trivilliansrx
  • summitspecialtypharmacy
  • ellisnottstreetrx
  • heartland-mansfield
  • medicinemanpharmacy-mainstreet
  • padekhealthcarepharmacyii
  • pulaskipharmacy
  • quickpharmacy
  • trullfamilypharmacy
  • vitalcareofprinceton
  • eric-test
  • heidispharmacy-wooster
  • levis
  • pharmacyplus-paterson2
  • preckshotprofessionalpharmacy
  • ricksdiscountdrugs
  • sinksrx-steelville
  • whitleypharmacy
  • wil-savdrugs-sweetwater
  • hollyparkpharmacy
  • bearlakedruggardencity
  • cape-raefordroad
  • coxsvarietyandpharmacy
  • hoganspharmacy
  • hoodspharmacymedicineshoppe
  • integrativepharmacyandwellness
  • marketrx
  • mcneasedrugs
  • medicenterpharmacy-cambridgecity
  • midtownpharmacy-kearny
  • omnifamilyhealth-butlerfresno
  • prescriptionpadpharmacy
  • riversidepharmacy-salisbury
  • stegenevievepharmacy
  • whidbeyhealthcommunityrx
  • thepharmacyatsingingriver
  • ayerfamilypharmacy
  • cherokeehealth-alcoa
  • omnifamilyhealthnewpanamagrove
  • optimalpharmacy
  • powerscompoundingpharmacy
  • puppet
  • quickmedspharmacy
  • southlandpharmacy
  • stvincentspharmacy-birmingham
  • andyspharmacy-cookeville
  • atholpharmacy
  • bayvillepharmacy
  • cannondrugs
  • cobornsrx-2035
  • friendlyrx
  • greenemedicalarts
  • hollandcommunitypharmacy
  • northernpharmacy
  • sunlifepharmacy-apachejunction
  • thrift-townhealthmart
  • cabrillopharmacy
  • cannonrx-salisbury
  • cascadespecialtyrx
  • chaircityrx
  • dchsretailpharmacy-florence
  • delcodrugs
  • edgemontpharmacy
  • fanninpharmacy
  • gatlinmedicalartspharmacy
  • jolleyssandypharmacy
  • laurelrx2
  • medicap-8036
  • medicap-8247
  • medonepharmacy-newmarket
  • modernpharmacyincorporated
  • pharmacy1-elcajon
  • piggottrx
  • sierrapharmacy
  • specialtyrxcare
  • striplingspharmacy
  • thepharmacy
  • saintmatthewspharmacy
  • digital-clevelandpharmacy-madera
  • buywisedrugs
  • farwellhealthcenterpharmacy
  • healthworkspharmacy
  • iconpharmacy
  • infuserveamericainc
  • pharmcarerx
  • scheerdrugs
  • starpharmacyandgifts
  • themedicinecabinet-2
  • tmcpharmacy
  • pittsfieldpharmacy
  • coltonpharmacy
  • cape-ramsey
  • clevelandpharmacy-madera
  • genevapharmacy
  • inoladrug
  • remingtondrugco
  • theprescriptionpad-fruitland
  • westonpharmacy
  • boydsdrugmart
  • hallscaremartpharmacy
  • hawthorne-lugoff
  • lifelinespecialtypharmacy
  • sunlifepharmacy-casagrande2
  • tinrxlatimerspharmacy
  • vandeldrug
  • woodrivermedicine
  • bluestonepharmacy
  • communitycarepharmacy-lewisville
  • familychoicepharmacy
  • impactcompounding
  • nashvillehealthcarepharmacy
  • solacecarepharmacy
  • westernnccommunityhealth
  • woodlakespharmacy
  • chetjohnsondrugsinc
  • vitalcareofsyracuse
  • truecompoundingpharmacy
  • brysoncitypharmacy
  • dannysrx-2
  • expressrx-hope
  • instantrx
  • oquirrhmountainrx-westvalley
  • sms-voice-responder
  • stmarypharmacy-chatsworth
  • uptonpharmacy
  • vitalcare-guilford
  • bayapharmacywest
  • brissondrugs
  • suncrestpharmacy
  • broadwayfamilypharmacy
  • brocktonpharmacy
  • communityclinicofhighpoint
  • cornerdrug
  • couchrx-sheridan
  • kramerpharmacy
  • lilboospharmacy
  • medicalpharmacy-albemarle
  • morrisplazapharmacyandsurgicalsupplies
  • qwikmed
  • syedintegrativehealth
  • auburnpharmacy-burlington
  • betterlifepharmacy-southriver
  • blackriverfallspharmacy
  • cobornsrx-2030
  • communityhealthcenterpharmacy
  • crossroads-menlo
  • doughertyspharmacy-dallas
  • gerouldsrx-2
  • hometownrx-springfield
  • jacob-test
  • medtownpharmacy
  • paxpharmacy
  • peopleshealthcenterrx
  • pharmacyplus-whitehall
  • rectordrug
  • thedrugstore
  • timberlinepharmacy
  • diketsprofessionaldrugs
  • eastsidepharmacy-lawton
  • fostershealthmartrx
  • goldenislesrx-2
  • integrityrxpharmacy
  • kaizencompoundingpharmacy
  • kelley-rosscompounding
  • kizerpharmacy
  • marionrx
  • newportpharmacy
  • rocklandpharmacy
  • salmonpharmacy
  • trianglepharmacy
  • univofkansas-indiancreek
  • urgentpharmacycarellc
  • genewellpharmacy
  • gpspharmacy
  • philshealthmart
  • uphamscommunitycarepharmacy
  • eaglepharmacy
  • fouchandsonpharmacy
  • hayatrx-4
  • mattsonpharmacy
  • pharmaprodia
  • prescriptionstogo-2
  • tackettcompoundingpharmacy
  • unioncommunitycare-dukestreet
  • clarkdrugs
  • elvington-drug
  • fievetpharmacy
  • horshamsquarepharmacy
  • kelley-ross-polyclinic
  • lufkinpharmacy
  • nyspharmacy
  • santabarbaramedicineshoppe
  • stapleypharmacy-downtown
  • vytosrx-hammond
  • whitemountain-overgaard
  • yrmcfoothillspharmacy
  • farmaciadelpueblo-elcentro
  • wesleysdev-fluent
  • altru-fmr
  • beringerdrugcenter
  • burlingtonpharmacy
  • cobornsrx-2039
  • gull-point-pharmacy
  • kellyspharmacy-centralfill
  • molloysmedicalarts
  • shakamakpharmacy
  • starcarepharmacy-prosper
  • towndrugs
  • syracuseuniversityhealthservicesrx
  • c-proxy
  • andrewspharmacy
  • citydrugstoreofhendersontninc
  • communitymedicinepharmacy
  • countrysidepharmacy
  • cwp-ormondbeach-1b40
  • drillingmorningsiderx
  • familyrx-allegroplaza
  • gallaherspharmacy
  • guysfamilypharmacy
  • matteshealthmartpharmacy
  • mountvernondrugcompany
  • pattersonhealthmart-claycenter
  • waukamountainpharmacy
  • sandersdrugs
  • clinicpharmacy-toccoa
  • davidcitydiscountpharmacy
  • dottiespharmacy
  • granitepharmacy-philipsburg
  • martinspharmacy204
  • medicap-8432
  • medicap-cascade
  • norfieldmedicalcenterpharmacy
  • prosperitydrugcompany-batesburg
  • rexpharmacy
  • trinitydiscountdrugs
  • chateaudrugsinc-metairie
  • limestonedrug
  • mcmahanpharmacy
  • proscriptpharmacy
  • saltillopharmacy
  • terrydrugs
  • thriftwaypharmacy-classon
  • vowuniversity10
  • hometowndrugennis
  • advancesjpharmacy
  • cwp-orangecity-3a64
  • eufaulapharmacy
  • gdnpharmacyllc
  • healthheropharmacy-wellpointe
  • lawrencedrug-springfield
  • ocalapharmacy
  • pelphreypharmacy
  • richmondhillpharmacy
  • southsiderx
  • valleyintegratedpharmacy
  • whittierhealthrx
  • nucara-greenfield
  • mountainlandpaysonrx
  • bobjohnsonspharmacy
  • anawanpharmacy
  • avenelpharmacy
  • barbeepharmacy
  • barronhometownpharmacy
  • bridgecarepharmacy
  • cambridgehealthalliance-specialty
  • carpenterdentdrugs
  • castlepharmacy
  • menifeecountypharmacy
  • monettediscount
  • gurleyspharmacy
  • carrollrx-clay
  • colerltc
  • familycarerx
  • lakelandrx-branson
  • mikesrx-2
  • newlondonpharmacy
  • robbinsvillepharmacy
  • sids-pharmacy
  • rosauerspharmacy-03
  • avitapharmacy-losangeles
  • beaufortpharmacy
  • brian-ivr
  • firesidepharmacy
  • healthparkrx-mtpleasant
  • kwikrxpharmacy
  • medicinemanpharmacy-schuyler
  • prescriptioncenterofossining
  • reedspharmacy5-berryville
  • westminsterpharmacyservices
  • ackalspharmacy
  • buddpharmacy
  • medicap-toledo
  • paulsensrx
  • potterdrug-petersburg
  • summersrx-sedalia
  • vow-lab
  • walpolepharmacy
  • arcare
  • babispharmacy
  • clarksbigcountryrx-delivery
  • cobornsrx-2047
  • gilchristpharmacyinc
  • goodrichpharmacyltc-anoka
  • harleyvilledrug
  • healthheropharmacy-rochesterhills
  • pharmacyspecialtiesandclinic
  • browndrugcompany
  • cashwiserx-3014
  • centralpharmacy-haslett
  • cobornsrx-2024
  • crossroadsspecialtypharmacy
  • eastovercooprx
  • gemdrugsreserve
  • gooddayrx-eaton
  • hayatrx-3
  • loudounpharmacy
  • medicalparkrx-newport
  • mortoncomprehensivehealth
  • truepharmacy-devine
  • ahmarx
  • arrowpharmacy-rome
  • asbellpharmacy
  • bandkprescriptionshop
  • chancydrugs-lakepark
  • christmaspharmacy
  • currypharmacy
  • harvardneighborhoodrx
  • healthshoppharmacy
  • lifestreampharmacy
  • medicineshoppe-rexburg
  • sinksrx-sullivan
  • stjohnshealth
  • summersrx-nevada
  • thomasdrug-broad
  • a1pharmacy
  • angelopharmacy
  • auburnpharmacy-eudora
  • betterhealthrxcorp
  • cascadiapharmacy
  • culinarypharmacyii
  • expressrx-paris
  • horseshoehealthandmedicine
  • howardfamilypharmacyofallen
  • juneaudrugcompany
  • lepantodiscount
  • longliferx2
  • marshallpharmacy-proact
  • martinlutherkingpharmacy
  • medicap-8207
  • oakhurstrx
  • realodrugs8
  • smithssthelenapharmacy
  • solutionspharmacyinc-ooltewah
  • spencesmedicalcenterrx-angleton
  • sterlingpharmacy-mtsterling
  • valleywellnesspharmacy
  • alliancecommunitypharmacy
  • baldwinpharmacy
  • coolidgepharmacy
  • daniels-barnwell
  • haddypharmacy
  • hayatrx-10
  • hilltopmarketrx
  • macespharmacy-belington
  • parklandrx-fredericktown
  • pharmacyplus-girard
  • smithspharmacy
  • southcountymentalhealth
  • wallyshongpharmacy
  • boydspharmacy-pemperton
  • lackiedrugstore
  • lincolnplacepharmacy
  • marshallpharmacy-mumc
  • medicinemanhaydenpharmacy
  • pasteurpharmacy
  • rogers-maryville
  • shenandoahpharmacy
  • sierracompounding
  • smithvillerx
  • superiorcompoundingpharmacy
  • unioncommunitycare
  • vow-tools
  • cedenospharmacy
  • greystonevillagerx
  • cwp-deleon-de67
  • expressrxpharmacyllc
  • fountainlakefamilypharmacy
  • harborpharmacy
  • healthpharmacy-usc
  • heartlandpharmacy-siloamsprings
  • houmafamilydrugs
  • lifechangerx
  • oceanamedical
  • owldrugstore
  • palubickispharmacy
  • phillydrugstore
  • jnrrx
  • eaglelakedrugs
  • eastmainpharmacy
  • medicap-8007
  • rosauerspharmacy-42
  • u-saveitrx-fortvalley
  • bloominggrovepharmacy
  • scheurerfamilyrx-caseville
  • texasroadpharmacy-applegarth
  • valleydrug-chewelah
  • lumistryuat
  • bonhamfamilydrug
  • bellin-health-pharmacy-ashwaubenon
  • buffaloprescriptionshop
  • carawaypharmacy
  • colonialdrugs
  • columbiacompounding
  • costalfamilyhealth-wiggins
  • davisdrugs
  • hancockpharmacy-iii
  • heb-4points
  • knightspharmacy
  • mainpharmacy
  • maxwellpharmacyinc
  • neighborcare-marrero
  • nucara-pleasanthill
  • physiciansbuildingpharmacy
  • pinebrookrx-2
  • sadlerhughes
  • stedmandrug
  • sumralldrugstore
  • travs-u-saverx
  • ublypharmacy
  • wamegodrug
  • carmichaeldrugs-monroe
  • coastalpharmacyandwellness
  • fax.dev.ondoapis
  • florenceinfusionservices-vitalcare
  • gaughnsdrugstore
  • hawks-prairie-pharmacy
  • marketplacerx-2583
  • medicalartsrx-lawrence
  • medicineshoppe-bellevue
  • multnomah-fernhill
  • northhillrx
  • springboropharmacy
  • tolsondrug
  • townandcountryrx
  • willowcreekpharmacy
  • avitapharmacy-melville
  • cannonrx-kannapolissouth
  • klingensmithsdrugstores-newbethlehem
  • sempertsdrug
  • standardrx-quarryst
  • summitpark
  • terrysrx-jacksboro
  • artcitypharmacy
  • bodedruginc-moundcity
  • community-first-pharmacy
  • eastgatepharmacy
  • frederickcommunitypharmacy
  • garfieldlowcostrx
  • goldenvalleyhealth
  • healthfirst-wakeforest
  • humepharmacy
  • nucara-marshalltown
  • stockmensdrug
  • syracuseu-savepharmacy
  • vowpuppet
  • warringtonwellnessrx
  • southernstarrx-003
  • boydspharmacy-medford
  • cornerstone-chenal
  • edwardspharmacy
  • expressrx-pinebluff
  • molterpharmacy
  • multnomah-northeast
  • multnomah-southeast
  • therobbinspharmacy
  • toddsrx-elizabethcity
  • wylietestbox
  • bearlakedrug
  • boydmedicinestore
  • curtis-claysville
  • elyrialowcostpharmacy
  • fawcettspharmacy
  • lakepharmacy-hiddenvalleylake
  • murphyssav-morpharmacy
  • nationsmedicines-burlewblvd
  • santafepharmacy
  • sypharmacy
  • techeactionclinicrx-franklin
  • thebowmandrugcompany
  • avitapharmacy-tulane
  • buyritedrugs-ozark
  • colbypharmacy
  • corporatepharmacyservice
  • landys-pharmacy
  • marshallmedicineshoppe
  • moose-midland
  • muniz-riogrande
  • oquirrhmountainpharmacy
  • rogers-stjoseph
  • rtws
  • u-saveitrx-dawsonroad
  • digital-anchorpharmacyandmedicalsupplies
  • albrechtspharmacy
  • cornerstoneapothecary-belleplaine
  • eldoradotruecarepharmacy
  • familydrugmart-sumrall
  • gatesrx-mtairy
  • hesstonpharmacy
  • jonesdrugstore
  • mccracken-waynesburg
  • medonepharmacy-middletown
  • pattersondailyhealthcarerx
  • pharmacyvalue
  • proxsysrx-corporate
  • willowcreekhealthmart
  • southlakedrug
  • asantepharmacy
  • assuremed
  • bellespharmacy
  • fax-test-1.ondoapis
  • josefs-raleigh
  • marrasdrugstore
  • mowrymedicalpharmacy
  • my.dev
  • reedspharmacy3
  • seminolecommunityrx
  • thegalaxydrugstore
  • vitalcare-grandrapids
  • whittierhealthrx-2
  • wilsonssavmor
  • andersonapothecary
  • cooperspharmacy
  • hollandpharmacy
  • indydrugco-blairsville
  • mariettadiscountrx
  • martinsquickmeds
  • montanaapothecaryandco
  • penlarpharmacy
  • sav-morpharmacy-pana
  • shavanopharmacy
  • taylorpharmacy
  • ahf-demo
  • alexanderpharmacy
  • bourbontownpharmacy
  • cashwiserx-3009
  • cornerdrugstore-wahpeton
  • crcarerx
  • expressrx-hamilton
  • johnsonfamilypharmacy
  • med-mart-lexington
  • paylessdrugs-morris
  • peoplescustomrx
  • roanmountainpharmacy-bakersville
  • rosauerspharmacy-36
  • savannahfamilypharmacy
  • thedrugstore-ironmountain
  • tishomingoexpressrx
  • tri-areacommunity-ferrum
  • vytosrx-hohmanave
  • angierfamilypharmacy
  • avitapharmacy-decatur
  • bennettpharmacyinc
  • cantnersdrugstore
  • citydrugs-vanalstyne
  • dillonfamilypharmacy
  • eldahmywellnessrx
  • familycare-rockhill
  • harveydrugabilene
  • iversoncornerdrug
  • lakecarmelpharmacy
  • moseslake
  • neinpharmacy
  • qe-ivr
  • rockvalleycompoundingpharmacy
  • silverpharmacy
  • simivalleyltc
  • vowuniversity9
  • wallsltc
  • tradewindspharmacy
  • advancedrx-richardson
  • atozpharmacy
  • bandysrx-salem
  • bellpharmacy
  • bjrxpharmacyltc
  • calhoundrugco
  • collegehometownpharmacy
  • eaglepharmaoutsourcing
  • hazelgreenpharmacy
  • hendersonpharmacy
  • johnspharmacy-highlands
  • solutionsrx
  • sunlifepharmacy-sanmanuel
  • apexpharmacyandhomecare
  • familyrx-southwilliamson
  • hcapharmacy
  • rosauerspharmacy-7
  • palmcare-nationalcity
  • broadcreekpharmacy
  • edendrug
  • extonpharmacyatmarchwood
  • group1
  • hayatrx-9
  • integrityrx-tomsriver
  • kubatrx-warehouse
  • mainstreetapothecary
  • marionpharmacyinc
  • northwestcompounding
  • nucara-cokato
  • rooseveltcitypharmacy
  • teamsterscarerx-charlestown
  • thepharmacyatthemedicalcenter
  • bennettspharmacy
  • digital-decaturdrugs
  • gerouldsrx-1
  • hayatrx-18
  • hinesvillerx
  • macsrx-powell
  • martinspharmacyofruralretreat
  • peachrxpharmacy
  • sav-morpharmacy-tuscola
  • swantonrexall
  • transithillpharmacy
  • u-saveitrx-centerville
  • vashonpharmacy
  • walldrugofpamplico
  • citydrug-paragould
  • dequeenhealthandwellness
  • grueneroadrx-hv
  • madisonpharmacy
  • mitchellsdrugstore-boulevard
  • mortonalwanpharmacy
  • narayanpharmacy3
  • ortizpharmacy
  • parkridgepharmacy
  • pembertonpharmacy-stmichaels
  • sirenpharmacy
  • spindaledrug
  • standardrx
  • thepharmacyatrush
  • wellness1rx-mason
  • westsidepharmacyandgifts
  • avalonprofessionalpharmacy
  • bestvaluehometown
  • cherokeehealth-lenoircity
  • christians-pharmacy-ga
  • cobornsrx-2016
  • crxpharmacy
  • demo
  • gordonspharmacyandgifts
  • newcityrx
  • pineknollrx
  • realodrugs7
  • timberridgepharmacy
  • unitedhealthcenters-sanjoaquinvalley
  • villagewalkpharmacy
  • vow13test
  • nicholsonssumnerpharmacy
  • 986pharmacy
  • 986pharmacy-8021
  • cobornsrx-2029
  • duncanspharmacyinc
  • grannickspharmacy
  • minneolapharmacy
  • realo-store17
  • sycamorehillspharmacy
  • curativemedicine
  • u-saveitrx-cairo
  • auburnpharmacy-paola
  • careconnectpharmacy
  • cookfamilyhealthcenter
  • costwisepharmacy
  • einsteinlivewellpharmacy
  • fiverivershealthcenterspharmacy-xenia
  • hellscanyonpharmacy
  • lakesidepharmacyandmedicalequipment
  • lyonsrx
  • mcleodchoicepharmacy-seacoast
  • medicinestop
  • midtownrx
  • msuhealthcarepharmacy
  • newclintonny
  • newgrahampharmacy
  • peoplespharmacy
  • perronepharmacy
  • tietonvillagedrugs
  • lenspharmacy
  • cherryclinicandpharmacy
  • crawford-breazeale-rx
  • gerouldsrx-4
  • harrisdrug
  • jackspharmacy
  • jandjdrugs
  • lovesrxandgifts-passchristian
  • palestinefamilypharmacy
  • torresfamilypharmacy-elsa
  • aplusfamilyhealthcare-brownsville
  • auburnpharmacy-nevada
  • claiborne-rx-homer
  • hawthorne-pelion
  • kellyspharmacy2
  • linkpharmacy-la
  • notchpharmacy
  • realo-specialtycare
  • redcliffsfamilypharmacy
  • sanjuandrug
  • taylorsvilledrugs
  • thriftywaypharmacy
  • daviscompoundingsolutions
  • familyhealthcenter-stmatthews
  • oaklanddrugs
  • randjdrugs
  • 15thstpharmacy
  • carlisle-pharmacy
  • clinic-hopemill
  • doanesvalleypharmacy
  • eastoverdrug
  • greenleaf
  • hayes-barton-pharmacy
  • heikepharmacy
  • kleins-kom-kmw
  • peoplesrx-4
  • prescriptioncentreandsurgicals
  • servicedrugpharmacy
  • southernpharmacy-statesboro
  • sparkmanhealthmartpharmacy
  • parkwoodpharmacy
  • kbpharmacy
  • expressrx-taylorsville
  • yourcommunitydiscountpharmacy
  • hayatrx-6
  • hmcpharmacy
  • medicineshoppe-1569
  • unitedpharmacyofyukon
  • cwp-birdrdhospice-3b86
  • lloyedcentralcompoundingrx
  • mixmedcompoundingpharmacy
  • stuckifamilypharmacy
  • totalcarepharmacy
  • yorkvillerx
  • pharmacyplusandsurgical-paterson
  • chapinrx
  • familydrugmart-poplarville
  • familyhealthpharmacy-greenville
  • greenhillpharmacy4
  • philsdiscount-laporte
  • usavepharmacy-hays
  • super1pharmacy-30
  • yourpharmacyoflexington
  • avitapharmacy-austin4
  • bataviacommunitypharmacy
  • buenavistafamilypharmacy
  • corerelief
  • courtyardpharmacy
  • kimspharmacy
  • lifecarerx
  • pineridgerx
  • prosperitypharmacy-manassas
  • sixthavenuepharmacy
  • thomasdrugsinc-newyork
  • vitalcareofnorthernvirginia
  • bestvalueridgleadrug
  • davenportpharmacy
  • highlandpharmacy
  • hometown-lawrenceburg
  • integrityrx-williamsport
  • randolphmedicalrx
  • rockvillerx
  • salinasrx-sanbenito
  • synergiscompoundingpharmacy
  • taborcitymedicinemart
  • thecompoundinglab-johnsoncity
  • valuerx-warsaw
  • vitalcare-southdallas
  • dev-api
  • tracktownpharmacy
  • healingspringspharmacy
  • seniorlifepharmacysales
  • citydrugstoreofhenderson
  • 360medicalcare
  • chetjohnsondrugs
  • conciergerx
  • dcapharmacy
  • farmaciareyes-sanalfonso
  • kratzershometownrx-wilmington
  • louisvillecompoundingpharmacy
  • marionfamilypharmacy
  • med-a-savepharmacy
  • millbrookpharmacy
  • newagepharmacy
  • owenslongtermcare
  • rigginspharmacy
  • spartandrug
  • santeintegrativepharmacy
  • cobornsrx-2028
  • jeffersondrugs
  • chaneyspharmacy
  • childrenspharmacyservices
  • dixie-elizabethtown
  • eastendpharmacy
  • foxdruginc
  • halldrugco
  • ipackpharmacy
  • perkinsdrugs
  • rootstown-community-rx
  • scriptlifepharmacy
  • stbethlehemdrugs
  • vitalcareoffrisco
  • citizenprofessionalpharmacy
  • murraysdrug-heppner
  • auburnpharmacy-parkville
  • bentleypharmacy
  • cobornsrx-2100
  • familycarepharmacy-totowa
  • hocks-tippcity
  • kelley-ross-union
  • mountidapharmacy
  • rosebankpharmacy
  • sinksrx-rolla
  • townandcountrydrug
  • auburnpharmacy-baldwin
  • bestbuydrugs
  • bouldercreekrx
  • centralpharmacy-batonrouge
  • gknrx
  • hancockpharmacy-ii
  • kjspharmacy
  • prairiehillsrx
  • realodrugs-lillington
  • ritzvilledrugcompany
  • rolladruginc
  • vowuniversity11
  • cornerdrug-woodland
  • downingtownmedshoppe
  • expressmedpharmacy-dededo
  • huntsilverlakedrug
  • jayspharmacy
  • mountainsidecompounding
  • newerapharmacy
  • personalized-rx
  • smartpharmacy
  • thewellnesscenterpharmacy
  • grangerpharmacy
  • homer
  • americanpharmacy
  • ashcraftpharmacy
  • innercarepharmacy
  • jordanpharmacy-graham
  • mathespharmacy-2
  • parklandrx-desloge
  • realodrugs-wilson
  • shadycovepharmacy
  • sojofamilyrx
  • tarrytownpharmacy
  • westholtpharmacy
  • oaklandpharmacy
  • 4urx
  • cfh-gulfport
  • cooperativehealthpharmacy
  • pricechopperpharmacy-7
  • realodrugs-hampstead
  • reusspharmacy
  • shorewoodspecialty
  • themcgrathpharmacy
  • u-savepharmacy-wayne
  • fiverivershc-xenia
  • avitapharmacy-satx-1074
  • belmartownpharmacy
  • hometown-chillicothe
  • keystonecarepharmacy
  • northfloridarxofchiefland
  • richlandhealthrx
  • smyrnacompoundingpharmacy
  • u-saveitrx-smithsstation
  • vcarepharmacy
  • fitchburgfamilypharmacy
  • guysmedicalcenterrx-mccomb
  • hagermanrx
  • illinihealthservices
  • medmetricsrx
  • techedrugs-lafayette
  • windhamnorth
  • economypharmacy-corporateoffice
  • clinicapharmacy-brawley
  • riggsdrug
  • abopharmacy-brooklyn
  • burryspharmacy
  • ciolinodrugs
  • cwp-beachblvd-1b15
  • guysolebrookpharmacy
  • marraspharmacy
  • masonfamily
  • quinlanspharmacy-montourfalls
  • boltonspharmacy
  • cobornsrx-2006
  • danvillepharmacy
  • lehanhealthmart
  • medicap-8422
  • regionalessentialrx
  • test-hb
  • middleman
  • springparkpharmacy
  • coastalfamilyhealth-mosspoint
  • kauppharmacy-minster
  • lakerdrug
  • louisburgfamilypharmacy
  • sinksrx-south
  • southerndrugcompany
  • yourcornerdrugstore
  • avitapharmacy-beaumont
  • broadstreetpharmacy-chesaning
  • careprocompounding
  • expressdrugssavannah
  • familypharmacycare
  • glennsapothecary
  • hydedrugstore
  • langleydrug
  • northernbedfordpharmacy
  • perfectionrx
  • realo-pinkhill
  • stapleypharmacy-dinocrossing
  • watertownhometownpharmacy
  • cherryclinic-medicalcenter
  • achorfamilyrx
  • apexpharmacy
  • applediscountdrugs
  • blountdiscountpharmacy-gillst
  • brookdalerx
  • cannonpharmacy
  • cobornsrx-2042
  • curemedpharmacy
  • develop-sandbox-two
  • djdrugs
  • eastportfamilypharmacy
  • heartcitydrug
  • huntingtonmedicineshoppe
  • mccoyspharmacy
  • newamsterdamdrugmart
  • preferredrx-houston
  • rosauerspharmacy-44
  • avitapharmacy-la-1002
  • bayviewpharmacyinc
  • medicalhomepharmacy-northolden
  • middlesexrx
  • morrisstationpharmacy
  • paulspharmacy
  • stlouishillsrx
  • avitapharmacy-warrendale
  • burkesmainstreetpharmacy
  • cartersfamilypharmacy
  • mainline-rx-cresson
  • mosscompoundingpharmacy
  • whitehorsepharmacy
  • capitolheightspharmacy
  • centrumspecialtypharmacy
  • crownpharmacy
  • csuhealthnetworkpharmacy
  • currypharmacy-slaughter
  • omnifamilyhealth-newshafter
  • sandjpharmacy-krum
  • saverexpresspharmacy
  • obrienpharmacy
  • prescriptionservicesinc
  • boswellprescriptioncenter
  • kaup-fortrecovery
  • tamarackpharmacy-rathdrum
  • buckleysdrugstore
  • cashwiserx-1806
  • clarksbigcountryrx-abilene
  • galaxypharmacy
  • heddenspharmacy
  • ourhomepharmacyatmedicalarts
  • parkavenuepharmacy
  • pharmaxpharmacy-leadington
  • shamrockspecialtyrx
  • spitaledrugs
  • thompsonscommunityrx
  • valumedpharmacy-midwestcity
  • laboticapharmacy
  • towndrugsandsurgical
  • waynepharmacy
  • bellevuedrugcompany
  • careonepharmacy-pennsylvaniaave
  • fowlervillepharmacy
  • kayceeltcrx
  • lakeviewpharmacy
  • omnifamilyhealth-wasco
  • onealsdrug-plymouth
  • rosauerspharmacy-29
  • sheltonpharmacy
  • tionestapharmacy
  • savemoredrugs
  • medonepharmacy-emmitsburg
  • tjpharmacy
  • auburnpharmacy-lamar
  • berrydrugofdardanelle
  • cannonenhancedcare
  • cashwiserx-3013
  • lakesidespecialty
  • r-excellenceprogram-man
  • rams-pharmacy2
  • sagharborpharmacy
  • southrobesonmedicalcenter
  • watsonrxsolutions
  • westhavenpharmacy
  • auburnpharmacyandcompounding
  • evolutionprimarycare
  • riversidepharmacy-gilbert
  • baggettrx
  • downtowndrug
  • medicineshoppe-1348
  • presidentialpharmacy
  • procompounding-1
  • towncrestpharmacy
  • comfortpharmacy
  • pharmacyplus-harrison
  • pikevillemedicalcenter
  • seashoredrug
  • vow
  • auroraprofessionalrx
  • civiccenterpharmacy
  • cornerstone-jfk
  • harrishealthmart
  • lensdrug
  • marshallpharmacy-bcc
  • mcalesterexpresspharmacy
  • oldtimedrugs
  • pharmacyspecialistsofcentralfl
  • u-saveitrx-northwest
  • uptownpharmacyinc
  • economydrug-eureka
  • klingensmithsdrugstores-numine
  • aandocompounding
  • blackoakhomemedical
  • develop-sandbox
  • deweypharmacy
  • forwardpharmacy-deerfield
  • lesliesdrugstore
  • lionpharmacy
  • martinspharmacyofdublin
  • purehealthpharmacyllc
  • rogers-tarkio
  • silverstagepharmacy
  • simply-purerx
  • valucarecenterhealthmart
  • whitewrightpharmacy
  • add-drug
  • brooklynpharmacy
  • citydrug-evanston
  • donlonpharmacy
  • fallsriverrx
  • medicineshoppe-1868
  • prescriptiondrugstore-hayti
  • qhrpharmacy-eastrussell
  • vitalcare-columbia
  • winterparkdrugs
  • avitapharmacy-brea
  • eldondrug
  • murraysdrug-boardman
  • avitapharmacy-austin3
  • burtspharmacydirect-thousandoaks
  • cranberrywoodstownhomes
  • cwp-ipsec-alma9-test
  • dogwoodpharmacy-tifton
  • neighborhoodpharmacy
  • neugardpharmacy
  • penningtonapothecary
  • pharmacysolutions-lincoln
  • rangelypharmacy
  • villageprescription
  • wenatcheeclinic
  • walkerpharmacy
  • capitolhillpharmacy
  • communityclinicalrx
  • evansdrugs-osceola
  • gulfcoastinfusion
  • hawthorne-sunset
  • healthcarepartnerspharmacy-johnsonville
  • linospharmacy-1
  • northportdrug
  • thepharmacyshopnew
  • theprescriptionpad
  • henryettadrug
  • innovarx
  • iukadiscountdrugs
  • lakeviewltcpharmacy
  • ordwayhealthmart
  • southparkpharmacy
  • starcarepharmacy
  • tinrx
  • westcolumbiacooprx
  • ultracarepharmacy-newbrunswick
  • api.beta
  • linkpharmacy-lakeforest
  • upperlevisaclinicrx
  • applebysdrugstore
  • clintondrugco
  • cornerdrug-winnemucca
  • cpn-uat
  • doctorspharmacy
  • hazlecompoundingpharmacy
  • langespharmacy
  • medrx
  • moorescompoundingpharmacy
  • paylessdrugs-besseme
  • phillipshealthmartpharmacy
  • pittsborodiscountdrug
  • southernstarrx-004
  • surecarediscountpharmacy
  • ballgroundpharmacy
  • basingerspharmacyinc
  • bryanpharmacy-enterprise
  • cannonrx-kannapolisnorth
  • familydrug-shelbyville
  • hopehealthpharmacy-irby
  • kamailio-sfo1
  • losalamitospharmacy
  • macsrx-oakridge
  • modocfamilypharmacy
  • multnomah-eastcounty
  • plentywoodrexalldrug
  • prairiepharmacy
  • riverwoodaitkinrx
  • valuerxpharmacy-richlands
  • brownspharmacy
  • hayatrx-14
  • hospitaldiscountrx-west
  • albuquerquecitydrug
  • hawthorne-aiken
  • jeffreysdrugstore
  • leoscatalinadrugstore
  • mh-gulfport
  • oldmainpharmacy
  • scotlandhealthcenterpharmacy
  • stuckeypharmacy
  • tullymedicalclinicrx
  • apothecarepharmacyiv-vinegrove
  • bonofamilypharmacy
  • bryandrugs-hospitaldr
  • colquittpharmacy
  • expressrx-nationalpark
  • johnsrx-farmington
  • jonescountydrugs
  • kingspharmacy
  • medicap-8052
  • melbranpharmacy
  • moose-concord
  • nucara-traer
  • qualitypharmacy
  • shriverspharmacy-mcconnelsville
  • stamfordcommunitypharmacy
  • stinesapothecary
  • uptowndruggoldenvalley
  • keystonepharmacy-grandrapids
  • medi-quikpharmacy-booneville
  • randdpharmacy
  • bestvalueronspharmacy
  • canalpharmacy
  • islanddrugandwellness
  • makerscompoundingpharmacy
  • specialtyrx-cullman
  • adamsdiscountpharmacy
  • carolinapharmacy-seagrove
  • dowddrug
  • highlandparkpharmacy
  • medicine-shoppe-artesia
  • rockcreekrx-coalmont
  • soldotnaprofessionalpharmacy
  • somcpharmacy-wheelersburg
  • themooredrugstore
  • warddrugstore
  • westcoastrxpharmacy-ventura
  • drugmartpharmacy
  • carepointpharmacy
  • camdenvillagerx
  • elixrx
  • frjpharmacy
  • gladwynepharmacy
  • medsave-legends
  • primecarerx
  • realodrugs22
  • shelbyvillepharmacy
  • southdixiepharmacy
  • thefamilypractice
  • valleywellness
  • vitalcare-lubbock
  • woodriverpharmacy
  • 77pharmacyinc
  • checotahpharmacy
  • cheekandscott
  • clayspharmacy
  • curexa
  • cwp-westkendall-eb47
  • desertpharmacy
  • drugfarmpharmacy
  • hurricanefamilyrx
  • lewisvilledrug
  • lumistry
  • mayodanrx
  • medicap-8011
  • mickeyfine
  • nucarepharmacy
  • nyespharmacy
  • professional-rx-pennsburg
  • rosauerspharmacy-14
  • snowhillpharmacy
  • sysadmin
  • trianglecompoundingpharmacy
  • valumarketrx-louisville
  • vitalcare-oklahomacity
  • blairpharmacy-fairfield
  • cartersatstonebridge
  • crossvillediscountdrugs
  • gloyerspharmacy
  • goodrichpharmacy-stfrancis
  • locustforkpharmacy
  • medicinecenterrx-canton
  • peacerx
  • plaqueminespharmacy
  • restorerx
  • southcarepharm
  • vitalcareofmorristown
  • familyrx-aiken
  • firstcare-salecreek
  • fordpharmacy
  • gooddayrx-wellington
  • hocks-charleston
  • iridiumpharmacy
  • pharma1
  • rosauerspharmacy-40
  • stansdrug
  • stclairmedicineshoppe
  • urbandalemedicaprx
  • bushyrunrx
  • hurleydrugs
  • southrivercompoundingrx-southside
  • uniondrug-va
  • saenzmedicalpharmacy-penitas
  • auburnpharmacy-abilene
  • avitapharmacy-abilene
  • bypassrx4
  • careplusrxpharmacy
  • keesevillepharmacy
  • medicalcenterrx
  • sunshinepharmacy
  • terrysrx-lafollette
  • theprescriptionshoppe-albany
  • 15rxpharmacy-2
  • hopehealthpharmacy-greeleyville
  • macsrx-knoxville
  • sinksrx-countrymart
  • actonpharmacy
  • avitapharmacy-neworleans
  • bonamipharmacy
  • cottonwooddrugs
  • dixie-louisville
  • eddystonecommunitypharmacy
  • hazeltonpharmacy
  • hometown-winchester
  • sullivanpharmacy-ar
  • sunraydrugs
  • communitypharmacyofsaccity
  • ariespharmacy
  • communitymedicinepharmacy-chester
  • franksrx
  • grapevinedrugrx
  • hopehealthpharmacy-orangeburg
  • milfordrxandhomecare
  • pharmaxpharmacy-imperial
  • reddishpharmacy
  • reedspharmacy4-martinsburg
  • specialtycarerx
  • adamsdrugstore
  • alaskafamilypharmacy-noblestoffice
  • beaverfallshealthmartpharmacy
  • bluewellsfamilypharmacy
  • louiesfamilypharmacy
  • medi-quikpharmacy-ozark
  • nationsmedicines-carterrd
  • realodrugs-clayton
  • rosauerspharmacy-37
  • solontowncrestpharmacy
  • pennlaurelpharmacy
  • acemedical
  • adeepharmacy
  • centralpharmacy
  • chancydrugs-hahira
  • cheneyrx
  • conwayoutpatientrx
  • economydrug-pikeville
  • economydrugs-sweethome
  • farmerspharmacymarket
  • fiveriverspharmacy
  • hbpharmacy
  • heritagechemistspharmacy
  • newpharmacy-yuccavalley
  • qrcpharmacy
  • rxcompletellc
  • servicedrugs-retail
  • shegerpharmacy
  • sykespharmacy-columbiafalls
  • newportcoastpharmacy
  • advancecommunityhealth-raleigh
  • sav-morpharmacy-louisville
  • btaxpros
  • chesapeakerx
  • dchsretailpharmacy
  • familyrx-enid-2
  • health-carepharmacy-morrilton
  • mabrys-drug
  • mainline-rx-blairsville
  • woodruffhealthmart
  • fortwilliamspharmacy
  • advanceddesign
  • arenadistrictpharmacy
  • avitapharmacy-montgomery
  • bandwpharmacy
  • davisislandspharmacy
  • elmorerx
  • fredspharmacy
  • greenhillrx
  • integratedhealthcarerx1-cop
  • lehighpharmacy
  • lowellspharmacyartesia
  • myersdrug
  • somcpharmacy-vanceburg
  • southwestrx
  • cashwiserx-1801
  • etownpharmacy
  • gatewaypharmacy
  • gunnisonfamilypharmacy
  • morganrx-batesburg
  • northmainrx
  • oakridgepharmacy-tn
  • russospharmacy
  • waimanalohealthcenterrx
  • accesshealthpharmacy-daniels
  • ar-expharmacy
  • avitapharmacy-satx-1077
  • josefs-durham
  • nationalspecialtypharmacy
  • northrockpharmacy
  • stvincentdepaul
  • veterinarypharmaceuticalsolutions
  • jose
  • gilespharmacy
  • thedrugstore-haskell
  • broadwaypharmacy
  • lakegregorypharmacy
  • lascassasdrugs
  • macespharmacy-philippi
  • mtcristopharmacy
  • newhopepharmacy
  • nicoletpharmacy
  • panoramapharmacy
  • professionalrx-greer
  • summersrx-slater
  • themedicinestore-tonganoxie
  • dunesfamilyrx
  • adamsdrugs-millbrook
  • carolinarx-hampton
  • dokimosnevadacityrx
  • eastendexpress
  • heartland-conway
  • heritagepharmacy
  • valleypharmacy-loveland
  • valuespecialtypharmacy
  • yourdrugstorerx
  • jerseycitypharmacy
  • avitapharmacy-eaglepass
  • bridgeportpharmacy
  • delta-charleston
  • familyrx-southaiken
  • fleetwoodpharmacy
  • joespharmacy-al
  • pershingpharmacy
  • thecliniconsixth
  • avitapharmacy-1082-harlingen
  • chapmanrx
  • dunnellonpharmacy
  • jacksondrugs-alexandercity
  • koshlandpharmacy
  • leroypharmacyii
  • medinafamilypharmacy
  • neumanndrug
  • newtongrovedrug
  • northstaterx
  • stvincentspharmacy-east
  • tlcpharmacy
  • vanmolllc
  • wiserx
  • marmadukepharmacy
  • cwp-hypoluxo-f514
  • avitapharmacy-rockhill
  • churchsquarepharmacy
  • clinicrx-guymon
  • islandrx
  • lawtoncommunityhealthcenter
  • mtvernonpharmacy-fallsway
  • cobornsrx-2019
  • commonwealthrx-chatham
  • communityhealthcare-puyallup
  • eldahmywellnessrx-chulavista
  • jadfamilypharmacy
  • kemperdrug
  • mesillavalleypharmacy
  • midtownmedicenterrx
  • putvindrugstore
  • tandcflynnspharmacyinc
  • theprescriptionparlour-1
  • township-pharmacy
  • villagepharmacyofsyosset
  • group3
  • battlefieldpharmacy
  • bestvalue-glenrose
  • dokimoseastmainrx
  • lifecarelibertydrugs
  • lovespharmacyofdiamondhead
  • morganrx-gilbert
  • nashvillefamilypharmacy
  • powellsbloomfieldpharmacy
  • powhatandrug
  • professionalrx-jasper
  • queenspricechopperrx-4
  • smithdrug1
  • straubmedicalcenteroutpatientrx
  • u-saveitrx-corporate
  • vhspharmacyatharborsedge
  • yrekapharmacy
  • armucheepharmacy
  • cobornsrx-2048
  • kashandkarry
  • pattersonfamilyapothecary
  • wyomingpharmacy
  • gooddaypharmacycorporate
  • adamsdrugs-east
  • bypassrx-chapmanville
  • expressrx-sherwood
  • medicalcenterpharmacy-savannah
  • medicenterpharmacy-loganprimary
  • modnurxincpharmacy
  • sav-ritepharmacyeast
  • sumnerpharmacy
  • timespharmacy-royalkunia
  • townandcountryrx-maplewood
  • huttonpharmacy
  • futrellpharmacy-richsquare
  • rosecarepharmacy
  • thelaitrampharmacy
  • bellewoodpharmacy
  • crescentpharmacy
  • eldoradomedicineshoppe
  • fishersvillefamilypharmacy
  • heartofflorida-main
  • juniperpharmacy
  • medicalartspharmacy-sanleandro
  • moose-mtpleasant
  • rockdrugstore
  • vitalis-pharmacy
  • yourgordonsvillerx
  • cobornsrx-2017
  • blackrockpharmacy
  • candcdrugs
  • crestlinepharmacy
  • driscollhealthpharmacy
  • easttennessee-lenoircity
  • familypharmacynaples
  • heightsspecialtypharmacy
  • internationaldrugs
  • knkpharmacy
  • medonepharmacy-mountairy
  • naranjahealthcenter
  • patricksquarerx
  • princetonpharmacy
  • rosespharmacy
  • springfielddrugstore
  • vineyardscripts
  • avitapharmacy-covina
  • byhaliadrug
  • cabrinipharmacy
  • choicespecialtyrx-sugarland
  • delmarvapharmacy
  • elixirxapothecary
  • expressrx-winnfield
  • forwardpharmacy-columbus
  • gibsondiscountpharmacy
  • klingensmithsdrugstores-fordcity
  • kubatrx-center
  • mtprospectpharmacy
  • phar-morerx
  • qualityhomehealthcare
  • thedrugstoreoneastside
  • thepillbox
  • u-saveitrx-macon
  • wendellpharmacy
  • appledrugs-crownheights
  • edspharmacy
  • globepharmacy
  • gooddayrx
  • hayatrx-2
  • hometownrxpeculiar
  • jodisrx
  • kearneyparkpharmacy
  • limestonepharmacy
  • medicap-panora
  • syracusecommunityhealthpharmacy
  • test-ee
  • americanhealthsolutions
  • boatwrightpharmacy
  • chapelstreetpharmacy
  • communityhealth-pasadena
  • davisondrugandstationery
  • erniespharmacyandwellness
  • expressrx-lewisburg
  • galesvillepharmacy
  • hocks-vandalia
  • ilwacopharmacy
  • paramorespharmacy
  • redlodgedrug
  • smc-ca
  • thecommunitypharmacy-turbeville
  • townpharmacy-sacramento
  • health-waysave-ondrugs
  • mathespharmacy
  • rankosstadiumpharmacy
  • timspharmacy
  • avitapharmacy-attleboro
  • benzerpharmacy
  • carmichaeldrugs-covington
  • coastalfamilyhealth-baystlouis
  • cwp-rainbow-1b51
  • deltadrug-portsulpher
  • expressrxpharmacy-llc
  • hoperx
  • mainsourcepharmacy
  • moosepharmacy-salisbury
  • rapharx
  • wakeforestdrug
  • markspharmacy-waynesville
  • avitapharmacy-mcallen
  • bluegrassdrug-campbellsburg
  • brokenarrowfamilydrug
  • itccompounding
  • jessica-test
  • lititzapothecary
  • pharmetriclaboratory
  • thorsbydrugs
  • trummdrug-glenwood
  • alaskafamilypharmacy-northpoleoffice
  • betterlifepharmacy-newbrunswick
  • bufordroadpharmacy
  • familycarediscountrx-orlando
  • harryspharmacy
  • hometown-kermit
  • jdrugs
  • lapalcodrugs
  • lifewellpharmacy
  • lodipharmacy
  • npsltcpharmacy
  • phillipsburgpharmacy
  • riverpointpharmacy
  • sav-morpharmacy-atwood
  • snitemanpharmacy
  • hamiltonpharmacy
  • aldridgesfamilypharmacy
  • aniceapothecary
  • api.dev
  • beaconprescriptions-newbritain
  • chrispharmacy-portvincent
  • cornerdrug-goldbeach
  • expressrx-lakeprovidence
  • familyandchildrensservices
  • farmaciacentral
  • goodbrotherspharmacy
  • milexdrug
  • pharmaxpharmacy-potosi
  • priceharrispharmacy
  • quincyrx
  • rxxpresshealthmartpharmacy
  • scottspharmacy-albany
  • springfieldpharmacy
  • wilsondrug
  • newronsondrug-workerscomp

Current DNS Records

A AAAA MX TXT NS SOA

45.77.127.116

n/a n/a n/a n/a n/a

Want useful, structured WHOIS and DNS data like this? Check out SecurityTrails

Raw Whois Results for 45.77.127.116

#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/resources/registry/whois/tou/
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/registry/whois/inaccuracy_reporting/
#
# Copyright 1997-2026, American Registry for Internet Numbers, Ltd.
#



# start

NetRange:       45.76.0.0 - 45.77.255.255
CIDR:           45.76.0.0/15
NetName:        CONSTANT
NetHandle:      NET-45-76-0-0-1
Parent:         NET45 (NET-45-0-0-0-0)
NetType:        Direct Allocation
OriginAS:       
Organization:   The Constant Company, LLC (CHOOP-1)
RegDate:        2015-04-24
Updated:        2022-09-20
Comment:        Geofeed https://geofeed.constant.com/
Ref:            https://rdap.arin.net/registry/ip/45.76.0.0


OrgName:        The Constant Company, LLC
OrgId:          CHOOP-1
Address:        319 Clematis St. Suite 900
City:           West Palm Beach
StateProv:      FL
PostalCode:     33401
Country:        US
RegDate:        2006-10-03
Updated:        2026-06-12
Comment:        https://www.constant.com/
Ref:            https://rdap.arin.net/registry/entity/CHOOP-1


OrgAbuseHandle: ABUSE1143-ARIN
OrgAbuseName:   Abuse Department
OrgAbusePhone:  +1-973-849-0500 
OrgAbuseEmail:  [email protected]
OrgAbuseRef:    https://rdap.arin.net/registry/entity/ABUSE1143-ARIN

OrgTechHandle: NETWO1159-ARIN
OrgTechName:   Network Operations
OrgTechPhone:  +1-973-849-0500 
OrgTechEmail:  [email protected]
OrgTechRef:    https://rdap.arin.net/registry/entity/NETWO1159-ARIN

OrgNOCHandle: NETWO1159-ARIN
OrgNOCName:   Network Operations
OrgNOCPhone:  +1-973-849-0500 
OrgNOCEmail:  [email protected]
OrgNOCRef:    https://rdap.arin.net/registry/entity/NETWO1159-ARIN

# end


# start

NetRange:       45.77.126.0 - 45.77.127.255
CIDR:           45.77.126.0/23
NetName:        NET-45-77-126-0-23
NetHandle:      NET-45-77-126-0-1
Parent:         CONSTANT (NET-45-76-0-0-1)
NetType:        Reassigned
OriginAS:       
Organization:   Vultr Holdings, LLC (VHL-60)
RegDate:        2017-11-03
Updated:        2017-11-03
Ref:            https://rdap.arin.net/registry/ip/45.77.126.0


OrgName:        Vultr Holdings, LLC
OrgId:          VHL-60
Address:        900 N. Alameda St.
Address:        Suite 200
City:           Los Angeles
StateProv:      CA
PostalCode:     90012
Country:        US
RegDate:        2015-03-05
Updated:        2024-04-04
Ref:            https://rdap.arin.net/registry/entity/VHL-60


OrgTechHandle: LYNCH267-ARIN
OrgTechName:   Lynch, Tomas 
OrgTechPhone:  +1-973-849-0500 
OrgTechEmail:  [email protected]
OrgTechRef:    https://rdap.arin.net/registry/entity/LYNCH267-ARIN

OrgTechHandle: VULTR-ARIN
OrgTechName:   Vultr Abuse
OrgTechPhone:  +1-973-849-0500 
OrgTechEmail:  [email protected]
OrgTechRef:    https://rdap.arin.net/registry/entity/VULTR-ARIN

OrgAbuseHandle: VULTR-ARIN
OrgAbuseName:   Vultr Abuse
OrgAbusePhone:  +1-973-849-0500 
OrgAbuseEmail:  [email protected]
OrgAbuseRef:    https://rdap.arin.net/registry/entity/VULTR-ARIN

# end



#
# ARIN WHOIS data and services are subject to the Terms of Use
# available at: https://www.arin.net/resources/registry/whois/tou/
#
# If you see inaccuracies in the results, please report at
# https://www.arin.net/resources/registry/whois/inaccuracy_reporting/
#
# Copyright 1997-2026, American Registry for Internet Numbers, Ltd.
#

This page displays the publicly-available WHOIS data for 45.77.127.116, which belongs to an unknown organization.

Recently Reported IPs:

๐Ÿ‡จ๐Ÿ‡ณ 219.129.236.174
๐Ÿ‡ฉ๐Ÿ‡ช 135.125.199.17
๐Ÿ‡ฎ๐Ÿ‡ณ 125.23.228.86
๐Ÿ‡ฌ๐Ÿ‡ง 35.203.210.101
๐Ÿ‡บ๐Ÿ‡ธ 216.25.89.89
๐Ÿ‡ซ๐Ÿ‡ฎ 147.185.133.130
๐Ÿ‡บ๐Ÿ‡ธ 147.185.132.45
๐Ÿ‡ฎ๐Ÿ‡น 88.149.228.20
๐Ÿ‡ท๐Ÿ‡ด 80.94.92.179
๐Ÿ‡ฒ๐Ÿ‡ฝ 201.137.22.146
๐Ÿ‡ง๐Ÿ‡ฟ 190.211.145.230
๐Ÿ‡จ๐Ÿ‡ด 186.180.130.170
๐Ÿ‡ซ๐Ÿ‡ท 146.70.194.236
๐Ÿ‡ฎ๐Ÿ‡ณ 117.211.74.211
๐Ÿ‡ง๐Ÿ‡ฌ 109.160.32.70
๐Ÿ‡ฎ๐Ÿ‡ท 95.38.179.72
๐Ÿ‡ณ๐Ÿ‡ฑ 45.148.10.151
๐Ÿ‡บ๐Ÿ‡ธ 2607:f8b0:400c:c00::129
๐Ÿ‡ฐ๐Ÿ‡ท 211.254.212.59
๐Ÿ‡ณ๐Ÿ‡ฑ 45.148.10.157