AbuseIPDB » WHOIS 69.90.243.121
69.90.243.121 IP Address Information
| ISP | iDigital Internet Inc. |
|---|---|
| Usage Type | Data Center/Web Hosting/Transit |
| Hostname | vps.mibcomputers.ca |
| Domain Name | idig.net |
| Country | 🇨🇦 Canada |
| City | Toronto, Ontario |
vps.mibcomputers.ca
Subdomains
- cpcontacts.semquo
- webmail.seminskywealth
- cpanel.cultureshockentertainment
- mail.semquo
- webmail.seminskyfinancial
- webmail.aurorasauna.ca
- cpcalendars.officialvanda
- www.cultureshockentertainment
- webdisk.mobile
- whm.trackingxrp.com
- cpcontacts.trackingxrp.com
- www.googlescraping
- mobile
- localhost
- ftp.officialvanda
- gutterstuff
- cpanel.bg
- webdisk.cultureshockentertainment
- cpanel.officialvanda
- webdisk.ontariopreppers
- webdisk.los-angeles-dj-service
- cpcontacts.montenegrobestestate
- cpcontacts
- cpcontacts.tennexsystems.ca
- cultureshockentertainment
- cpcalendars.gutterstuff
- seminskyfinancial
- cpcalendars
- cpanel.ocdjdoc
- cpanel.annualpreppersmeet
- cpanel.mobile
- ftp.gutterstuff
- localhost.ocdjdoc
- tennexsystems.ca
- cpcalendars.cultureshockentertainment
- cpcalendars.los-angeles-dj-service
- webmail.ocdjdoc
- whm.seminskywealth
- ocdjdoc
- cpcalendars.bg
- webmail.montenegrobestestate
- www.semquo
- cpanel.los-angeles-dj-service
- www.preppertrifecta
- www.wa-wc
- webmail.canadianbelgianhorse.com
- whm.gutterstuff
- localhost.semquo
- www.aurorasauna.ca
- bg
- ftp.semquo
- www.ontariopreppers
- cpcalendars.ocdjdoc
- webdisk.seminskyfinancial
- cpcalendars.canadianbelgianhorse.com
- vpsnew
- webmail.tennexsystems.ca
- webdisk.ocdjdoc
- www.gutterstuff
- cpcalendars.montenegrobestestate
- cpcalendars.hahahahahabox.com
- webmail.seminskyfinancialgroup
- cpanel.montenegrobestestate
- cpcontacts.elleite
- webmail.elleite
- mail.elleite
- webmail.los-angeles-dj-service
- cpcontacts.ontariopreppers
- whm.ocdjdoc
- whm.hahahahahabox.com
- mail.los-angeles-dj-service
- webmail.cultureshockentertainment
- webdisk.seminskyfinancialgroup
- whm.annualpreppersmeet
- whm.cultureshockentertainment
- www.hahahahahabox.com
- ftp
- cpcontacts.los-angeles-dj-service
- webdisk.semquo
- cpcalendars.tennexsystems.ca
- cpcalendars.annualpreppersmeet
- cpcontacts.officialvanda
- webdisk.seminskywealth
- cpcalendars.mobile
- ftp.cultureshockentertainment
- webdisk.elleite
- webmail.officialvanda
- cpcontacts.mobile
- localhost.gutterstuff
- cpcontacts.ocdjdoc
- ftp.los-angeles-dj-service
- cpcontacts.preppertrifecta
- whm.seminskyfinancial
- cpcontacts.canadianbelgianhorse.com
- cpcontacts.seminskyfinancialgroup
- whm
- ns1
- www.montenegrobestestate
- www.officialvanda
- webmail.annualpreppersmeet
- whm.preppertrifecta
- webmail.bg
- cpanel.seminskywealth
- googlescraping
- ftp.elleite
- localhost.elleite
- ns2
- cpcontacts.hahahahahabox.com
- hahahahahabox.com
- webdisk.montenegrobestestate
- www.preppersmeet.com
- cpcontacts.aurorasauna.ca
- preppertrifecta
- webmail.ontariopreppers
- webmail.trackingxrp.com
- preppersmeet.com
- seminskywealth
- cpanel.preppertrifecta
- cpanel.trackingxrp.com
- www.seminskyfinancialgroup
- cpcalendars.googlescraping
- whm.bg
- www.mobile
- whm.tennexsystems.ca
- webdisk.bg
- localhost.los-angeles-dj-service
- montenegrobestestate
- cpanel.gutterstuff
- www.annualpreppersmeet
- localhost.cultureshockentertainment
- cpcontacts.seminskyfinancial
- www
- www.bg
- mail.gutterstuff
- webdisk.tennexsystems.ca
- www.seminskyfinancial
- cpcalendars.preppertrifecta
- cpcalendars.seminskyfinancial
- webdisk.annualpreppersmeet
- www.seminskywealth
- whm.googlescraping
- cpcalendars.aurorasauna.ca
- webmail.semquo
- mail.montenegrobestestate
- webdisk.preppertrifecta
- cpcontacts.gutterstuff
- webdisk.hahahahahabox.com
- cpanel.aurorasauna.ca
- cpcalendars.ontariopreppers
- whm.canadianbelgianhorse.com
- aurorasauna.ca
- www.canadianbelgianhorse.com
- www.tennexsystems.ca
- cpcalendars.elleite
- www.los-angeles-dj-service
- webmail.mobile
- cpanel.seminskyfinancial
- trackingxrp.com
- vps
- webmail.gutterstuff
- clients
- webdisk.officialvanda
- officialvanda
- elleite
- cpanel.googlescraping
- cpanel.semquo
- whm.montenegrobestestate
- cpcalendars.semquo
- cpcontacts.googlescraping
- los-angeles-dj-service
- webdisk.gutterstuff
- webdisk.aurorasauna.ca
- cpcalendars.seminskyfinancialgroup
- webdisk.googlescraping
- whm.ontariopreppers
- cpcalendars.seminskywealth
- mail.ocdjdoc
- mail.officialvanda
- whm.aurorasauna.ca
- webdisk.trackingxrp.com
- www.clients
- canadianbelgianhorse.com
- cpanel.ontariopreppers
- whm.seminskyfinancialgroup
- mail.cultureshockentertainment
- wa-wc
- webdisk
- cpcontacts.annualpreppersmeet
- webmail
- whm.elleite
- localhost.montenegrobestestate
- webmail.preppertrifecta
- cpanel.elleite
- www.ocdjdoc
- whm.mobile
- cpcontacts.bg
- whm.semquo
- cpcalendars.trackingxrp.com
- ontariopreppers
- seminskyfinancialgroup
- www.elleite
- cpanel.seminskyfinancialgroup
- semquo
- cpanel
- cpcontacts.cultureshockentertainment
- cpanel.canadianbelgianhorse.com
- annualpreppersmeet
- webdisk.canadianbelgianhorse.com
- cpanel.tennexsystems.ca
- cpcontacts.seminskywealth
- ftp.ocdjdoc
- whm.officialvanda
- whm.los-angeles-dj-service
- www.trackingxrp.com
- webmail.googlescraping
Current DNS Records
| A | AAAA | MX | TXT | NS | SOA |
|---|---|---|---|---|---|
| n/a | n/a | n/a | n/a | n/a |
Want useful, structured WHOIS and DNS data like this? Check out 
Raw Whois Results for 69.90.243.121
# # ARIN WHOIS data and services are subject to the Terms of Use # available at: https://www.arin.net/resources/registry/whois/tou/ # # If you see inaccuracies in the results, please report at # https://www.arin.net/resources/registry/whois/inaccuracy_reporting/ # # Copyright 1997-2026, American Registry for Internet Numbers, Ltd. # # start NetRange: 69.90.240.0 - 69.90.247.255 CIDR: 69.90.240.0/21 NetName: PEER1-BINARY-11 NetHandle: NET-69-90-240-0-2 Parent: NET69 (NET-69-0-0-0-0) NetType: Direct Allocation OriginAS: Organization: Aptum Technologies (PER1) RegDate: 2003-11-06 Updated: 2025-06-25 Comment: For abuse issues please e-mail [email protected]. All Comment: other inquiries can be directed to [email protected]. Our 24 x 7 NOC is Comment: available at 866-484-2588 Ref: https://rdap.arin.net/registry/ip/69.90.240.0 OrgName: Aptum Technologies OrgId: PER1 Address: 191 The West Mall City: Etobicoke StateProv: ON PostalCode: M9C 5L6 Country: CA RegDate: Updated: 2023-08-09 Ref: https://rdap.arin.net/registry/entity/PER1 OrgAbuseHandle: ATAE-ARIN OrgAbuseName: Aptum Technologies AUP Enforcement OrgAbusePhone: +1-678-365-2835 OrgAbuseEmail: [email protected] OrgAbuseRef: https://rdap.arin.net/registry/entity/ATAE-ARIN OrgTechHandle: APTUM-ARIN OrgTechName: Aptum Technologies OrgTechPhone: +1-866-484-2588 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/APTUM-ARIN RNOCHandle: ZP55-ARIN RNOCName: PEER 1 Network Inc RNOCPhone: +1-866-484-2588 RNOCEmail: [email protected] RNOCRef: https://rdap.arin.net/registry/entity/ZP55-ARIN # end # start NetRange: 69.90.243.0 - 69.90.243.255 CIDR: 69.90.243.0/24 NetName: PEER1-IDIGITAL-INTERNET-INC NetHandle: NET-69-90-243-0-1 Parent: PEER1-BINARY-11 (NET-69-90-240-0-2) NetType: Reassigned OriginAS: Customer: iDigital Internet Inc. (C05633080) RegDate: 2015-02-26 Updated: 2025-06-25 Ref: https://rdap.arin.net/registry/ip/69.90.243.0 CustName: iDigital Internet Inc. Address: 705 - 850 West Hastings Street City: Vancouver StateProv: BC PostalCode: V6C 1E1 Country: CA RegDate: 2015-02-26 Updated: 2015-02-26 Ref: https://rdap.arin.net/registry/entity/C05633080 OrgAbuseHandle: ATAE-ARIN OrgAbuseName: Aptum Technologies AUP Enforcement OrgAbusePhone: +1-678-365-2835 OrgAbuseEmail: [email protected] OrgAbuseRef: https://rdap.arin.net/registry/entity/ATAE-ARIN OrgTechHandle: APTUM-ARIN OrgTechName: Aptum Technologies OrgTechPhone: +1-866-484-2588 OrgTechEmail: [email protected] OrgTechRef: https://rdap.arin.net/registry/entity/APTUM-ARIN RNOCHandle: ZP55-ARIN RNOCName: PEER 1 Network Inc RNOCPhone: +1-866-484-2588 RNOCEmail: [email protected] RNOCRef: https://rdap.arin.net/registry/entity/ZP55-ARIN # end # # ARIN WHOIS data and services are subject to the Terms of Use # available at: https://www.arin.net/resources/registry/whois/tou/ # # If you see inaccuracies in the results, please report at # https://www.arin.net/resources/registry/whois/inaccuracy_reporting/ # # Copyright 1997-2026, American Registry for Internet Numbers, Ltd. #
This page displays the publicly-available WHOIS data for 69.90.243.121, which belongs to an unknown organization.